Protein
MCA_02375_1
Length
210 amino acids
Gene name: LOC1
Description: 60S ribosomal subunit assembly/export protein LOC1
Browser: contigB:1097253-1097968+
RNA-seq: read pairs 723, FPKM 42.3, percentile rank 61.6% (100% = highest expression)
Protein function
| Annotation: | LOC1 | 60S ribosomal subunit assembly/export protein LOC1 | |
|---|---|---|---|
| KEGG: | K14817 | LOC1 | 60S ribosomal subunit assembly/export protein LOC1 |
| EGGNOG: | 0PPA9 | LOC1 | Required for efficient assembly and nuclear export of the 60S ribosomal subunit |
| SGD closest match: | S000001897 | LOC1 | 60S ribosomal subunit assembly/export protein LOC1 |
| CGD closest match: | CAL0000180322 | LOC1 | 60S ribosomal subunit assembly/export protein LOC1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01836_1 | 69.85% | 136 | 3e-41 | MIA_01836_1 |
| A0A0J9X418_GEOCN | 66.13% | 124 | 4e-36 | Similar to Saccharomyces cerevisiae YFR001W LOC1 Nuclear protein involved in asymmetric localization of ASH1 mRNA OS=Geotrichum candidum GN=BN980_GECA02s06368g PE=4 SV=1 |
| A0A1E3PDF2_9ASCO | 52.21% | 136 | 2e-25 | 60S ribosomal subunit assembly/export protein LOC1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84128 PE=4 SV=1 |
| A0A167FH86_9ASCO | 51.49% | 134 | 1e-23 | Loc1p OS=Sugiyamaella lignohabitans GN=LOC1 PE=4 SV=1 |
| LOC1_YARLI | 54.68% | 139 | 5e-21 | 60S ribosomal subunit assembly/export protein LOC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LOC1 PE=3 SV=1 |
| UniRef50_Q6C8H2 | 54.68% | 139 | 1e-17 | 60S ribosomal subunit assembly/export protein LOC1 n=6 Tax=Saccharomycetales TaxID=4892 RepID=LOC1_YARLI |
| A0A060TD21_BLAAD | 52.85% | 123 | 2e-20 | ARAD1D03718p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D03718g PE=4 SV=1 |
| LOC1_YEAST | 37.69% | 130 | 7e-09 | 60S ribosomal subunit assembly/export protein LOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LOC1 PE=1 SV=1 |
| LOC1_CANAL | 38.53% | 109 | 8e-08 | 60S ribosomal subunit assembly/export protein LOC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LOC1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3216
Predicted cleavage: 15
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_02375_1 MAKFKKKVATITRENTSEIKRDKLAQNRLAVKSKNYENALANEGKKKSGLITKNGKVKKIVANPLLVKKAKQRVYTEKEL NIPKLNTAINPEGVKRGRGKKGKIFADNDAMMRILDTVTAKVDNTNASKLEKARQLEAIREAKRKEIERKEKEKAQKLQE KKQELKKGKSKSKKSSKSLDEIDMHIDDDSPQEEEESNKSGKKKKKVSFA
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.