Protein

MCA_02342_1

Length
288 amino acids

Browser: contigB:991772-992639-

RNA-seq: read pairs 1093, FPKM 46.7, percentile rank 63.8% (100% = highest expression)

Protein function

EGGNOG:0PR62NTP binding protein
SGD closest match:S000002591PLP1Phosducin-like protein 1

Protein alignments

%idAln lengthE-value
MIA_01122_146.47%2691e-55MIA_01122_1
A0A0J9X4J8_GEOCN36.00%2254e-25Similar to Saccharomyces cerevisiae YDR183W PLP1 Protein that interacts with CCT (Chaperonin containing TCP-1) complex and has a role in actin and tubulin folding OS=Geotrichum candidum GN=BN980_GECA02s05675g PE=4 SV=1
UniRef50_A0A0J9X4J836.00%2258e-22Similar to Saccharomyces cerevisiae YDR183W PLP1 Protein that interacts with CCT (Chaperonin containing TCP-1) complex and has a role in actin and tubulin folding n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X4J8_GEOCN
Q6CI83_YARLI29.19%1612e-17YALI0A00781p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A00781g PE=4 SV=1
A0A060SWJ9_BLAAD27.91%2582e-15ARAD1A05566p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A05566g PE=4 SV=1
A0A1E3PIA7_9ASCO30.53%1905e-14Thioredoxin-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_66060 PE=4 SV=1
PLP1_YEAST34.78%694e-07Phosducin-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PLP1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0655

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 288

Detailed signature matches

  1. Domain IPR012336
    Thioredoxin-like fold
    1. SSF52833 (Thioredox...)
  2. Domain IPR013766
    Thioredoxin domain
    1. PF00085 (Thioredoxin)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.40.30.10
  3. mobidb-lite (disord...)

Protein sequence

>MCA_02342_1
MDYKSSKILSQYQENLVKSSFNSDDENDQSDIDSLLELLDDEDDPVMARYREQRVQQLNQEIKNSQDRVTDSSTVETLTS
EVELFQLTTGLDSSVIKGGAKPDSKFDTSTALSSSSGPNLKIRSKYRSVIVHFFQPTFRTCKLVDECFTKLARSHFNTTK
FVRIDAARDAPFLSQKFNISVLPTVLCFTADAVGTAPKMSKKFTGLDEFLDSQTRSKLIANPQAVESLVRQLDAKFVESV
LMRVGALYRSSVISNTTESIAGSNNSISGPKIYNNNPNNDSDDDDLDI

GO term prediction

Biological Process

GO:0045454 cell redox homeostasis

Molecular Function

None predicted.

Cellular Component

None predicted.