Protein
MCA_02339_1
Length
156 amino acids
Gene name: RPS31
Description: Ubiquitin-40S ribosomal protein S31; Fusion protein cleaved to yield ribosomal protein S31 and ubiquitin
Browser: contigB:981551-982022-
RNA-seq: read pairs 81867, FPKM 6443.0, percentile rank 99.8% (100% = highest expression)
Protein function
Annotation: | RPS31 | Ubiquitin-40S ribosomal protein S31; Fusion protein cleaved to yield ribosomal protein S31 and ubiquitin | |
---|---|---|---|
KEGG: | K02977 | RP-S27Ae | small subunit ribosomal protein S27Ae |
EGGNOG: | 0PN07 | FG10941.1 | ubiquitin-40S ribosomal protein S31 fusion protein |
SGD closest match: | S000004157 | RPS31 | Ubiquitin-40S ribosomal protein S31 |
CGD closest match: | CAL0000178202 | UBI3 | Ubiquitin-ribosomal 40S subunit protein S31 fusion protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_01120_1 | 94.84% | 155 | 2e-82 | MIA_01120_1 |
A0A060TD73_BLAAD | 86.54% | 156 | 8e-73 | ARAD1D04840p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D04840g PE=4 SV=1 |
A0A1E3PSR8_9ASCO | 82.35% | 153 | 7e-67 | Ubiquitin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49111 PE=4 SV=1 |
Q6C290_YARLI | 84.42% | 154 | 1e-65 | YALI0F09790p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F09790g PE=4 SV=1 |
Q5A109_CANAL | 81.82% | 154 | 2e-64 | Ubiquitin-ribosomal 40S subunit protein S31 fusion protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBI3 PE=4 SV=1 |
UniRef50_A0A1D2VD35 | 81.65% | 158 | 8e-62 | Ubiquitin-domain-containing protein n=53 Tax=Eukaryota TaxID=2759 RepID=A0A1D2VD35_9ASCO |
A0A1E4TEY1_9ASCO | 82.35% | 153 | 6e-64 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2000 PE=4 SV=1 |
RS31_YEAST | 83.33% | 150 | 2e-62 | Ubiquitin-40S ribosomal protein S31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS31 PE=1 SV=3 |
A0A0J9X6Q9_GEOCN | 73.51% | 151 | 6e-57 | Similar to Saccharomyces cerevisiae YLR167W RPS31 Fusion protein cleaved to yield ribosomal protein S31 and ubiquitin OS=Geotrichum candidum GN=BN980_GECA04s01363g PE=4 SV=1 |
A0A167BXV7_9ASCO | 94.12% | 68 | 3e-40 | Ubiquitin OS=Sugiyamaella lignohabitans GN=UBI4 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2998
Protein family membership
- Ubiquitin (IPR019956)
Domains and repeats
-
Domain
1
20
40
60
80
100
120
140
156
Detailed signature matches

Unintegrated signatures
-
-
cd01803 (Ubiquitin)
Residue annotation
-
Ubq - UCH interact...
-
Ubq - E2 interacti...
-
Ubq - CUE interact...
Protein sequence
>MCA_02339_1 MQIFVKTLTGKTITLEVESSDSIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYNIQKESTLHLVLRLRGGGKKR KKKVYTTPKKIKHKRKKVKLSVLSYYKVADDGSVTRLRRECNNCGPGVFMANMKKNTYNVERQYCGRCGLTLVVEK
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Cellular Component
GO:0005840 ribosome