Protein

MCA_02339_1

Length
156 amino acids


Gene name: RPS31

Description: Ubiquitin-40S ribosomal protein S31; Fusion protein cleaved to yield ribosomal protein S31 and ubiquitin

Browser: contigB:981551-982022-

RNA-seq: read pairs 81867, FPKM 6443.0, percentile rank 99.8% (100% = highest expression)

Protein function

Annotation:RPS31Ubiquitin-40S ribosomal protein S31; Fusion protein cleaved to yield ribosomal protein S31 and ubiquitin
KEGG:K02977RP-S27Ae small subunit ribosomal protein S27Ae
EGGNOG:0PN07FG10941.1ubiquitin-40S ribosomal protein S31 fusion protein
SGD closest match:S000004157RPS31Ubiquitin-40S ribosomal protein S31
CGD closest match:CAL0000178202UBI3Ubiquitin-ribosomal 40S subunit protein S31 fusion protein

Protein alignments

%idAln lengthE-value
MIA_01120_194.84%1552e-82MIA_01120_1
A0A060TD73_BLAAD86.54%1568e-73ARAD1D04840p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D04840g PE=4 SV=1
A0A1E3PSR8_9ASCO82.35%1537e-67Ubiquitin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49111 PE=4 SV=1
Q6C290_YARLI84.42%1541e-65YALI0F09790p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F09790g PE=4 SV=1
Q5A109_CANAL81.82%1542e-64Ubiquitin-ribosomal 40S subunit protein S31 fusion protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBI3 PE=4 SV=1
UniRef50_A0A1D2VD3581.65%1588e-62Ubiquitin-domain-containing protein n=53 Tax=Eukaryota TaxID=2759 RepID=A0A1D2VD35_9ASCO
A0A1E4TEY1_9ASCO82.35%1536e-64Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2000 PE=4 SV=1
RS31_YEAST83.33%1502e-62Ubiquitin-40S ribosomal protein S31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS31 PE=1 SV=3
A0A0J9X6Q9_GEOCN73.51%1516e-57Similar to Saccharomyces cerevisiae YLR167W RPS31 Fusion protein cleaved to yield ribosomal protein S31 and ubiquitin OS=Geotrichum candidum GN=BN980_GECA04s01363g PE=4 SV=1
A0A167BXV7_9ASCO94.12%683e-40Ubiquitin OS=Sugiyamaella lignohabitans GN=UBI4 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2998

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 156

Detailed signature matches

    1. PR00348 (UBIQUITIN)
    1. SSF54236 (Ubiquitin...)
    1. SM00213 (ubq_7)
    2. PF00240 (ubiquitin)
    3. PS50053 (UBIQUITIN_2)
    1. SSF57829 (Zn-bindin...)
    1. PF01599 (Ribosomal_S27)
    2. SM01402 (Ribosomal_...)
    1. PS00299 (UBIQUITIN_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd01803 (Ubiquitin)

Residue annotation

  1. Ubq - UCH interact...
  2. Ubq - E2 interacti...
  3. Ubq - CUE interact...

Protein sequence

>MCA_02339_1
MQIFVKTLTGKTITLEVESSDSIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYNIQKESTLHLVLRLRGGGKKR
KKKVYTTPKKIKHKRKKVKLSVLSYYKVADDGSVTRLRRECNNCGPGVFMANMKKNTYNVERQYCGRCGLTLVVEK

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome
GO:0005515 protein binding

Cellular Component

GO:0005840 ribosome