Protein

MCA_02338_1

Length
148 amino acids


Gene name: MRPL19

Description: 54S ribosomal protein L19, mitochondrial

Browser: contigB:980810-981354+

RNA-seq: read pairs 1946, FPKM 161.4, percentile rank 85.7% (100% = highest expression)

Protein function

Annotation:MRPL1954S ribosomal protein L19, mitochondrial
KEGG:K02867RP-L11 large subunit ribosomal protein L11
EGGNOG:0PNVDFG06204.1mitochondrial 54S ribosomal protein YmL19
SGD closest match:S000005129MRPL1954S ribosomal protein L19, mitochondrial
CGD closest match:CAL0000178684MRPL19Mitochondrial 54S ribosomal protein YmL19

Protein alignments

%idAln lengthE-value
MIA_01119_189.93%1495e-93MIA_01119_1
A0A0J9X7X7_GEOCN81.63%1471e-85Similar to Saccharomyces cerevisiae YNL185C MRPL19 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA04s01374g PE=3 SV=1
A0A1E3PF67_9ASCO69.01%1423e-70Ribosomal protein L11 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53012 PE=3 SV=1
A0A060T9Q0_BLAAD68.24%1482e-67ARAD1D20328p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D20328g PE=3 SV=1
UniRef50_W0TAR663.95%1475e-6454S ribosomal protein L19 n=42 Tax=Fungi TaxID=4751 RepID=W0TAR6_KLUMA
RM19_YEAST61.54%1566e-6754S ribosomal protein L19, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL19 PE=1 SV=1
A0A167CB72_9ASCO72.27%1193e-61Mitochondrial 54S ribosomal protein YmL19 OS=Sugiyamaella lignohabitans GN=MRPL19 PE=3 SV=1
Q5AAS9_CANAL64.79%1422e-57Mitochondrial 54S ribosomal protein YmL19 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRPL19 PE=3 SV=1
Q6C874_YARLI61.49%1486e-56YALI0D22088p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D22088g PE=3 SV=1
A0A1E4TB60_9ASCO60.13%1582e-56Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_58038 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3171

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 148

Detailed signature matches

    1. MF_00736 (Ribosomal...)
    2. SM00649 (rl11c)
    3. cd00349 (Ribosomal_L11)
    1. SSF54747 (Ribosomal...)
    2. PF03946 (Ribosomal_...)
    1. PF00298 (Ribosomal_L11)
    2. SSF46906 (Ribosomal...)
Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. L7/L12 interface c...
  2. 23S rRNA interface...
  3. putative thiostrep...
  4. L25 interface cd00...

Protein sequence

>MCA_02338_1
MSKKVSAAKDVLIKLIVGAAQATPSPPVGPALGSKGVKAIDFCKEFNARTAHFNPGTPIPTVVTVKPDRTFSFEVKSPPT
AWLILKAAGVEKGIAHGKDPAVGTISLKHVYEIAKIKKTDERHKNLQLEGIVRTILGTAKSVGVNVIP

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome