Protein
MCA_02295_1
Length
295 amino acids
Gene name: SYS1
Description: Protein SYS1
Browser: contigB:838639-839527-
RNA-seq: read pairs 1669, FPKM 69.7, percentile rank 72.5% (100% = highest expression)
Protein function
Annotation: | SYS1 | Protein SYS1 | |
---|---|---|---|
KEGG: | K20318 | SYS1 | protein SYS1 |
EGGNOG: | 0PP55 | FG10794.1 | integral membrane protein |
SGD closest match: | S000003541 | SYS1 | Protein SYS1 |
CGD closest match: | CAL0000189893 | SYS1 | Sys1p |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_00840_1 | 79.59% | 147 | 1e-79 | MIA_00840_1 |
A0A0J9X5P5_GEOCN | 66.21% | 145 | 8e-62 | Similar to Saccharomyces cerevisiae YJL004C SYS1 Integral membrane protein of the Golgi required for targeting of the Arf-like GTPase Arl3p to the Golgi OS=Geotrichum candidum GN=BN980_GECA03s02694g PE=4 SV=1 |
UniRef50_A0A0J9X5P5 | 66.21% | 145 | 2e-58 | Similar to Saccharomyces cerevisiae YJL004C SYS1 Integral membrane protein of the Golgi required for targeting of the Arf-like GTPase Arl3p to the Golgi n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X5P5_GEOCN |
A0A060T3H8_BLAAD | 61.59% | 138 | 4e-54 | ARAD1C33484p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C33484g PE=4 SV=1 |
A0A1E3PJD7_9ASCO | 63.85% | 130 | 2e-51 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83091 PE=4 SV=1 |
Q6CE45_YARLI | 54.26% | 129 | 1e-40 | YALI0B18656p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B18656g PE=4 SV=1 |
A0A1D8PRK2_CANAL | 47.01% | 134 | 2e-33 | Sys1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SYS1 PE=4 SV=1 |
SYS1_YEAST | 39.88% | 173 | 9e-31 | Protein SYS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYS1 PE=1 SV=1 |
A0A1E4TIB8_9ASCO | 37.04% | 135 | 3e-22 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_71760 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0778
Predicted cleavage: 148
Protein family membership
- Integral membrane protein SYS1-related (IPR019185)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_02295_1 MPNYLSRLMSITSLFKSNSKTSDISLRPRKPLSSYYYSTDSYLSPSHIFRQIVTLQLIYYGIGTALILFTCLMAGRPEFS LKLVFSWTPVTSKTTLGWTLFMLWLLDTVFSVIALTVVVGRSKLALDFTLTLHGIHLVICWFVDGRFPASALWWGLQFLS IILMVILGTWTTQWRELRATFFENVPLDGGSIRQPIAMVDLEAQTQTLSTPVQQPAANSSPQAALLSTYNEYELEESEDE GDKKPSKSNNVTKQGLEAPEKDSSKGSSASRKMDESIGDESGDSDDGDISSLLKR
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.