Protein

MCA_02280_1

Length
216 amino acids


Browser: contigB:793671-794322-

RNA-seq: read pairs 67463, FPKM 3841.4, percentile rank 99.0% (100% = highest expression)

Protein function

KEGG:K02865RP-L10Ae large subunit ribosomal protein L10Ae
EGGNOG:0PGQQFG06924.1Ribosomal protein
SGD closest match:S000003103RPL1B60S ribosomal protein L1-B
CGD closest match:CAL0000174170RPL10A60S ribosomal protein L10a

Protein alignments

%idAln lengthE-value
MIA_03844_192.59%2166e-135MIA_03844_1
A0A0F7RS81_GEOCN91.67%2162e-132Ribosomal protein OS=Geotrichum candidum GN=BN980_GECA03s03915g PE=3 SV=1
A0A167EKR9_9ASCO87.04%2163e-126Ribosomal protein OS=Sugiyamaella lignohabitans GN=RPL1A PE=3 SV=1
UniRef50_A0A167EKR987.04%2167e-123Ribosomal protein n=33 Tax=Eukaryota TaxID=2759 RepID=A0A167EKR9_9ASCO
A0A060TD27_BLAAD86.11%2165e-123Ribosomal protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D44462g PE=3 SV=1
Q6C3V2_YARLI85.12%2152e-121Ribosomal protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E31911g PE=3 SV=1
A0A1E3PPJ4_9ASCO84.19%2156e-121Ribosomal protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81781 PE=3 SV=1
A0A1E4TIW1_9ASCO82.87%2161e-120Ribosomal protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_74417 PE=3 SV=1
RL10A_CANAL83.87%2175e-11960S ribosomal protein L10a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL10A PE=3 SV=2
RL1B_YEAST81.11%2177e-11760S ribosomal protein L1-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL1B PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.5517

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 200 216

Detailed signature matches

    1. cd00403 (Ribosomal_L1)
    2. PF00687 (Ribosomal_L1)
    1. PIRSF002155 (RPL1p_...)
    1. SSF56808 (Ribosomal...)
    1. PS01199 (RIBOSOMAL_L1)
Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. mRNA/rRNA interfac...

Protein sequence

>MCA_02280_1
MSKIASKDVRETVKQLLEASEKKKRNFLETIELQIGLKNYDPQRDKRFSGTIKLPEVPRPNMTVCVFGDAVDVDRAKAAG
VDAMSVEDLKKLNKNKKLIKKLAKKYNAFIASETLIKQVPRLLGPQLSKAGKFPTPVSHNEDLVGKVREVRSTIKFQLKK
VLCLAVAVGNVEMEEDQIVTQIMMAANFLVSLLKKHWQNVGSLTIKSTMGPPFRIY

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome

Cellular Component

GO:0015934 large ribosomal subunit