Protein

MCA_02253_1

Length
663 amino acids

Gene name: GEM1

Description: Outer mitochondrial membrane GTPase, subunit of the ERMES complex

Browser: contigB:720050-722115+

RNA-seq: read pairs 1297, FPKM 24.1, percentile rank 46.7% (100% = highest expression)

Protein function

Annotation:GEM1Outer mitochondrial membrane GTPase, subunit of the ERMES complex
KEGG:K07870RHOT1 mitochondrial Rho GTPase 1 [EC:3.6.5.-]
EGGNOG:0PH4WGEM1Mitochondrial GTPase involved in mitochondrial trafficking (By similarity)
SGD closest match:S000000046GEM1Mitochondrial Rho GTPase 1
CGD closest match:CAL0000185710GEM1Mitochondrial Rho GTPase 1

Protein alignments

%idAln lengthE-value
MIA_04026_176.36%6600.0MIA_04026_1
A0A0J9XA16_GEOCN69.70%6600.0Mitochondrial Rho GTPase OS=Geotrichum candidum GN=BN980_GECA06s03904g PE=3 SV=1
A0A1E3PG75_9ASCO64.80%6590.0Mitochondrial Rho GTPase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52648 PE=3 SV=1
A0A161HJN2_9ASCO62.43%6760.0Mitochondrial Rho GTPase OS=Sugiyamaella lignohabitans GN=GEM1 PE=3 SV=1
A0A060T8I7_BLAAD63.74%6730.0Mitochondrial Rho GTPase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C37378g PE=3 SV=1
GEM1_YARLI62.44%6470.0Mitochondrial Rho GTPase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GEM1 PE=3 SV=1
UniRef50_Q6C2J162.44%6470.0Mitochondrial Rho GTPase 1 n=4 Tax=saccharomyceta TaxID=716545 RepID=GEM1_YARLI
A0A1E4TBQ3_9ASCO52.33%6880.0Mitochondrial Rho GTPase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_134671 PE=3 SV=1
GEM1_YEAST54.56%6470.0Mitochondrial Rho GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEM1 PE=1 SV=1
GEM1_CANAL56.76%5920.0Mitochondrial Rho GTPase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GEM1 PE=3 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0600

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 100 200 300 400 500 600 663

Detailed signature matches

  1. Family IPR001806
    Small GTPase superfamily
    1. PF00071 (Ras)
  2. Family IPR021181
    Mitochondrial Rho GTPase
    1. PIRSF037488 (Miro)
  3. Domain IPR020860
    MIRO domain
    1. PS51423 (MIRO)
  4. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  5. Domain IPR011992
    EF-hand domain pair
    1. SSF47473 (EF-hand)
  6. Domain IPR002048
    EF-hand domain
    1. PS50222 (EF_HAND_2)
    2. SM00054 (efh_1)
  7. Domain IPR013567
    EF hand associated, type-2
    1. PF08356 (EF_assoc_2)
  8. Domain IPR013566
    EF hand associated, type-1
    1. PF08355 (EF_assoc_1)
  9. SITE IPR018247
    EF-Hand 1, calcium-binding site
    1. PS00018 (EF_HAND_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. G3DSA:1.10.23...
  3. G3DSA:3.40.50...
  4. NON_CYTOPLASM... (N...)
  5. PR00449 (RASTRNSFRMNG)
  6. SM00173 (ras_sub_4)
  7. TMhelix
  8. TRANSMEMBRANE (Tran...)
  9. cd01892 (Miro2)
  10. mobidb-lite (disord...)

Residue annotation

  1. G1 box cd01892
  2. GTP/Mg2+ binding s...
  3. Switch I region cd...
  4. G2 box cd01892
  5. G3 box cd01892
  6. Switch II region c...
  7. G4 box cd01892
  8. G5 box cd01892

Protein sequence

>MCA_02253_1
MTNDSIRVVVCGDEGVGKSSLITTLVKDTFVPNIQKVLPPITIPKDVSQSPLDSSPSSTVIIDTSSDPLESEALDRELKR
ANVIWLVYSGHYSCERISLFWMPYFRSRGVNLPVVLCANQRVETSSAESEHAIQDEMIPIMEEFKEIQACIRCNAKTHYN
VNEAFYLCQRAVTHPITPLFDTKGGCLKLTCVQALRRIFFLSDFDQDGYLSDKEFYLLQMKCFKKIMEPRELAEIKALLK
NASPTAVLETDVVGAPSGISEEGFILLNQIFAVKGRHETIWGILRAFHYTDSLSLADSFLYPQLDVPELSTVELSPEGYR
FLVDLFVLFDKDNDGGLNQSELKSLFKPTPGIPKLWQEFNFPHSTVRNEQGNDITLQGWLAQWSMTTNLDYKTTMEYLAL
LGFESSLQHQQLMSNSLRLNSVPSSRKITDGLKVTRPRKRRNPKSRSYRNSTVDRSVFNCFVVGSRGSGKTSLLTAFLNR
PFSEEYSPTIKPITVVNSVEVQGGKQCYLILEELGELELAILDNQARLEHCDVLCCTYDSSDPESFAYLVQLREKYPLID
NLPAVYVALKADLDRQQQRSDQQPDVYTRELKIPVPLHVSVQWRSALNELFIQLAEAARNPGSATPRMSDEEEDETLMPT
LVIAGVVGAVVILASWMWRSSNR

GO term prediction

Biological Process

GO:0007005 mitochondrion organization

Molecular Function

GO:0003924 GTPase activity
GO:0005509 calcium ion binding
GO:0005525 GTP binding

Cellular Component

GO:0031307 integral component of mitochondrial outer membrane