Protein
MCA_02249_1
Length
72 amino acids
Gene name: VMA9
Description: V-type proton ATPase subunit e
Browser: contigB:712112-713769-
RNA-seq: read pairs 1269, FPKM 214.8, percentile rank 88.9% (100% = highest expression)
Protein function
| Annotation: | VMA9 | V-type proton ATPase subunit e | |
|---|---|---|---|
| KEGG: | K02153 | ATPeV0E | V-type H+-transporting ATPase subunit e |
| EGGNOG: | 0PRUE | VMA9 | Vacuolar atp synthase subunit |
| SGD closest match: | S000028508 | VMA9 | V-type proton ATPase subunit e |
| CGD closest match: | CAL0000188556 | orf19.2343.1 | H(+)-transporting V0 sector ATPase subunit e |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XKS0_GEOCN | 72.22% | 72 | 8e-34 | Similar to Saccharomyces cerevisiae YCL005W-A VMA9 Vacuolar H+ ATPase subunit e of the V-ATPase V0 subcomplex OS=Geotrichum candidum GN=BN980_GECA32s02760g PE=4 SV=1 |
| UniRef50_A0A0J9XKS0 | 72.22% | 72 | 2e-30 | Similar to Saccharomyces cerevisiae YCL005W-A VMA9 Vacuolar H+ ATPase subunit e of the V-ATPase V0 subcomplex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XKS0_GEOCN |
| A0A1E3PLX9_9ASCO | 72.60% | 73 | 2e-33 | Putative secreted protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82260 PE=4 SV=1 |
| MIA_04030_1 | 65.22% | 69 | 3e-29 | MIA_04030_1 |
| A0A1D8PEY4_CANAL | 69.57% | 69 | 1e-27 | H(+)-transporting V0 sector ATPase subunit e OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2343.1 PE=4 SV=1 |
| VA0E_YEAST | 60.56% | 71 | 2e-27 | V-type proton ATPase subunit e OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA9 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0451
Protein family membership
- ATPase, V0 complex, subunit e1/e2 (IPR008389)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF05493 (ATP_synt_H)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_02249_1 MSGWNVIFVFVACAVLSAGAWVFAPKQDTTVWRSSIILTLAMCYIMWAITYLVQLHPLVQPRRSDLRPEFAE
GO term prediction
Biological Process
GO:0015991 ATP hydrolysis coupled proton transport
Molecular Function
GO:0015078 hydrogen ion transmembrane transporter activity
Cellular Component
GO:0033179 proton-transporting V-type ATPase, V0 domain