Protein

MCA_02232_2

Length
51 amino acids

Gene name: RPL39

Description: 60S ribosomal protein L39

Browser: contigB:665995-666476-

RNA-seq: read pairs 24619, FPKM 5849.9, percentile rank 99.8% (100% = highest expression)

Protein function

Annotation:RPL3960S ribosomal protein L39
KEGG:K02924RP-L39e large subunit ribosomal protein L39e
EGGNOG:0PRU9RPL39Ribosomal protein L39
SGD closest match:S000003725RPL3960S ribosomal protein L39

Protein alignments

%idAln lengthE-value
MIA_03956_182.00%501e-24MIA_03956_1
UniRef50_S3C7Y172.55%512e-1960s ribosomal protein l39 n=4 Tax=sordariomyceta TaxID=715989 RepID=S3C7Y1_OPHP1
A0A1E3PRN0_9ASCO72.55%514e-22Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_63568 PE=3 SV=1
A0A1D8PDT4_CANAL74.51%511e-21Ribosomal 60S subunit protein L39 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_C106470WA PE=3 SV=1
A0A0F7RS18_GEOCN70.59%511e-20Similar to Saccharomyces cerevisiae YJL189W RPL39 Ribosomal 60S subunit protein L39 OS=Geotrichum candidum GN=BN980_GECA01s04949g PE=3 SV=1
A0A060T836_BLAAD68.63%511e-20ARAD1D03872p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D03872g PE=3 SV=1
B5FVE0_YARLI70.59%511e-19YALI0D05697p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D05697g PE=3 SV=1
RL39_YEAST70.59%514e-1460S ribosomal protein L39 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL39 PE=1 SV=3
A0A1E4TF47_9ASCO70.59%511e-13Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_106055 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9573
Predicted cleavage: 30

Protein family membership

Domains and repeats

  1. Domain
1 5 10 15 20 25 30 35 40 45 51

Detailed signature matches

  1. Family IPR000077
    Ribosomal protein L39e
    1. MF_00629 (Ribosomal...)
    2. PF00832 (Ribosomal_L39)
  2. Domain IPR023626
    Ribosomal protein L39e domain
    1. SSF48662 (Ribosomal...)
    2. G3DSA:1.10.16...
  3. SITE IPR020083
    Ribosomal protein L39e, conserved site
    1. PS00051 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PD007914
  2. mobidb-lite (disord...)

Protein sequence

>MCA_02232_2
MAAHKTLRTKQKLAKAQKQNRPVPQWYRLKTVNPVRYNQKRRHWRRTKLNI

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome