Protein

MCA_02199_1

Length
186 amino acids

Gene name: TRS20

Description: Trafficking protein particle complex subunit 20

Browser: contigB:571166-571819+

RNA-seq: read pairs 477, FPKM 31.5, percentile rank 54.0% (100% = highest expression)

Protein function

Annotation:TRS20Trafficking protein particle complex subunit 20
KEGG:K20301TRAPPC2 trafficking protein particle complex subunit 2
EGGNOG:0PNM4TRS20Trafficking protein particle complex subunit 2
SGD closest match:S000000458TRS20Trafficking protein particle complex subunit 20
CGD closest match:CAL0000197935TRS20TRAPP subunit

Protein alignments

%idAln lengthE-value
MIA_04003_167.74%1865e-77MIA_04003_1
A0A0J9XJJ1_GEOCN57.53%1863e-70Similar to Saccharomyces cerevisiae YBR254C TRS20 One of 10 subunits of the transport protein particle (TRAPP) complex of the cis-Golgi which mediates vesicle docking and fusion OS=Geotrichum candidum GN=BN980_GECA22s01099g PE=4 SV=1
A0A060SZ83_BLAAD53.23%1868e-66ARAD1C03168p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C03168g PE=4 SV=1
A0A1E3PNL5_9ASCO51.08%1864e-64Sedlin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81640 PE=4 SV=1
Q6C760_YARLI46.77%1861e-55YALI0E03520p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E03520g PE=4 SV=1
UniRef50_G1WYF545.95%1855e-49Uncharacterized protein n=1 Tax=Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) TaxID=756982 RepID=G1WYF5_ARTOA
A0A167ETF0_9ASCO69.51%824e-40Trs20p OS=Sugiyamaella lignohabitans GN=TRS20 PE=4 SV=1
Q5A920_CANAL33.85%1922e-30TRAPP subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRS20 PE=4 SV=1
TRS20_YEAST29.77%2155e-28Trafficking protein particle complex subunit 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRS20 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0052

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 186

Detailed signature matches

  1. Family IPR006722
    Trafficking protein particle complex subunit 2
    1. PF04628 (Sedlin_N)
  2. Domain IPR011012
    Longin-like domain
    1. SSF64356 (SNARE-like)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.45...
  2. mobidb-lite (disord...)

Protein sequence

>MCA_02199_1
MSYYFTIIGTKDAPIYELEFGTHRQGGDGVAKFPQEMREINPFIVHSSLDVLEDVQWTTNQLYLKVIDNYYGYMVSAMCT
AGNIRFLLLHKPGTSSSSGGTGSGLGGGSGSSSSLVSGTTGVVSSSSGTSGSLVSASHIEEPIRQFFFDVYDLYVKTLLS
PFYFVNQPITSQVFDQKVRALGKKYL

GO term prediction

Biological Process

GO:0006810 transport
GO:0006888 ER to Golgi vesicle-mediated transport

Molecular Function

None predicted.

Cellular Component

GO:0005622 intracellular