Protein
MCA_02195_1
Length
206 amino acids
Gene name: BOS1
Description: Protein transport protein BOS1
Browser: contigB:557804-558425-
RNA-seq: read pairs 569, FPKM 34.0, percentile rank 56.2% (100% = highest expression)
Protein function
Annotation: | BOS1 | Protein transport protein BOS1 | |
---|---|---|---|
KEGG: | K08496 | GOSR2 | golgi SNAP receptor complex member 2 |
EGGNOG: | 0PJYZ | BOS1 | transport protein BOS1 |
SGD closest match: | S000004068 | BOS1 | Protein transport protein BOS1 |
CGD closest match: | CAL0000190829 | orf19.2940 | Protein transport protein BOS1 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_03999_1 | 57.42% | 209 | 1e-81 | MIA_03999_1 |
A0A0J9XCG1_GEOCN | 54.15% | 205 | 3e-71 | Protein transport protein BOS1 OS=Geotrichum candidum GN=BN980_GECA09s01253g PE=3 SV=1 |
A0A060T5L8_BLAAD | 49.27% | 205 | 1e-66 | Protein transport protein BOS1 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B07810g PE=3 SV=1 |
UniRef50_U4LDP2 | 41.43% | 210 | 2e-49 | Protein transport protein BOS1 n=3 Tax=saccharomyceta TaxID=716545 RepID=U4LDP2_PYROM |
A0A1E3PNR6_9ASCO | 42.03% | 207 | 4e-52 | Protein transport protein BOS1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_40241 PE=3 SV=1 |
BOS1_YARLI | 40.98% | 205 | 6e-44 | Protein transport protein BOS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BOS1 PE=3 SV=1 |
A0A1E4TCZ5_9ASCO | 37.80% | 209 | 8e-36 | Protein transport protein BOS1 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_27907 PE=3 SV=1 |
Q5AIB3_CANAL | 34.25% | 181 | 1e-23 | Protein transport protein BOS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2940 PE=3 SV=1 |
BOS1_YEAST | 38.46% | 91 | 2e-12 | Protein transport protein BOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOS1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1015
Protein family membership
- GOSR2/Membrin/Bos1 (IPR027027)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PIRSF028865 (Membrin-2)
-

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
-
NON_CYTOPLASM... (N...)
-
PF12352 (V-SNARE_C)
-
SSF58038 (SNARE fus...)
-
-
TRANSMEMBRANE (Tran...)
-
cd15863 (SNARE_GS27)
-
mobidb-lite (disord...)
Residue annotation
-
heterotetramer int...
-
zero layer cd15863
Protein sequence
>MCA_02195_1 MATLTRTLDQYETTASQELVVEKKNQAQTRIEGFRTELKEMREELVRLKQIRSDGLYEKNRSELIERRVNHTGTHTHQRH NSGNLNDGDISENPYTHNNSSSRSDGTYTNMTREEGMLKEHDVLSRAGDQLDEFLERGRMVLENLGEQREMLLNTRRKIY SVANTLGISNETIRLVERRAKQDKRIFYGGLILLIVCFYYIIKWFL
GO term prediction
Biological Process
GO:0006810 transport
Molecular Function
GO:0005484 SNAP receptor activity
Cellular Component
GO:0005794 Golgi apparatus