Protein
MCA_02144_1
Length
158 amino acids
Gene name: CTF8
Description: Chromosome transmission fidelity protein 8
Browser: contigB:352671-353148+
RNA-seq: read pairs 107, FPKM 8.3, percentile rank 22.9% (100% = highest expression)
Protein function
Annotation: | CTF8 | Chromosome transmission fidelity protein 8 | |
---|---|---|---|
KEGG: | K11270 | CTF8 | chromosome transmission fidelity protein 8 |
SGD closest match: | S000001234 | CTF8 | Chromosome transmission fidelity protein 8 |
CGD closest match: | CAL0000178874 | CTF8 | Ctf8p |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_03839_1 | 45.62% | 160 | 2e-30 | MIA_03839_1 |
A0A167D4L7_9ASCO | 39.08% | 174 | 2e-27 | Chromosome transmission fidelity protein 8 OS=Sugiyamaella lignohabitans GN=CTF8 PE=4 SV=1 |
UniRef50_A0A167D4L7 | 39.08% | 174 | 6e-24 | Chromosome transmission fidelity protein 8 n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A167D4L7_9ASCO |
A0A0J9X5W9_GEOCN | 42.68% | 157 | 1e-25 | Similar to Saccharomyces cerevisiae YHR191C CTF8 Subunit of a complex with Ctf18p that shares some subunits with Replication Factor C and is required for sister chromatid cohesion OS=Geotrichum candidum GN=BN980_GECA03s03970g PE=4 SV=1 |
A0A060T590_BLAAD | 35.08% | 191 | 9e-24 | ARAD1B02772p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B02772g PE=4 SV=1 |
A0A1E3PEG2_9ASCO | 29.41% | 170 | 5e-14 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47642 PE=4 SV=1 |
Q6C6Z4_YARLI | 25.36% | 138 | 4e-11 | YALI0E05071p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E05071g PE=4 SV=1 |
CTF8_YEAST | 27.81% | 151 | 8e-09 | Chromosome transmission fidelity protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTF8 PE=1 SV=1 |
Q59XA3_CANAL | 27.75% | 173 | 2e-08 | Ctf8p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CTF8 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0167
Protein family membership
- Chromosome transmission fidelity protein 8 (IPR018607)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_02144_1 MPLAIIETDAQRPKISDKIELPNVLRTPSGLVLIEIQGTVHIGSRTLSSTGGLGLQSENEQDKSTQLSNTNDEPDLIGKF DFSDLEKGGNSVTLVVDQHQRLRGKLEKLKKPLAILRIDGQQKEGTAKSPVRIPVVDVVSQKLIFSSRPEPIVYTEQS
GO term prediction
Biological Process
GO:0007064 mitotic sister chromatid cohesion
Molecular Function
None predicted.
Cellular Component
GO:0031390 Ctf18 RFC-like complex