Protein
MCA_02122_1
Length
184 amino acids
Gene name: MRPL20
Description: 54S ribosomal protein L20, mitochondrial
Browser: contigB:299458-300013-
RNA-seq: read pairs 3404, FPKM 227.4, percentile rank 89.5% (100% = highest expression)
Protein function
Annotation: | MRPL20 | 54S ribosomal protein L20, mitochondrial | |
---|---|---|---|
EGGNOG: | 0PQUD | FG10355.1 | mitochondrial 54S ribosomal protein YmL20 |
SGD closest match: | S000001793 | MRPL20 | 54S ribosomal protein L20, mitochondrial |
CGD closest match: | CAL0000183938 | orf19.2639 | Mitochondrial 54S ribosomal protein YmL20 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_05472_1 | 72.03% | 143 | 5e-70 | MIA_05472_1 |
A0A0J9XI48_GEOCN | 64.54% | 141 | 9e-66 | Similar to Saccharomyces cerevisiae YKR085C MRPL20 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA18s00406g PE=4 SV=1 |
UniRef50_A0A0J9XI48 | 64.54% | 141 | 2e-62 | Similar to Saccharomyces cerevisiae YKR085C MRPL20 Mitochondrial ribosomal protein of the large subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XI48_GEOCN |
A0A167FTM5_9ASCO | 54.61% | 141 | 1e-46 | Mitochondrial 54S ribosomal protein YmL20 OS=Sugiyamaella lignohabitans GN=MRPL20 PE=4 SV=1 |
A0A060T6R9_BLAAD | 54.74% | 137 | 4e-42 | ARAD1C22462p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C22462g PE=4 SV=1 |
A0A1E3PQ39_9ASCO | 50.00% | 140 | 1e-37 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49788 PE=4 SV=1 |
Q6CF94_YARLI | 39.13% | 138 | 1e-31 | YALI0B09075p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B09075g PE=4 SV=1 |
RM20_YEAST | 39.07% | 151 | 3e-21 | 54S ribosomal protein L20, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL20 PE=1 SV=2 |
A0A1E4T9N1_9ASCO | 30.61% | 147 | 2e-16 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_33034 PE=4 SV=1 |
Q59QT4_CANAL | 33.64% | 110 | 1e-10 | Mitochondrial 54S ribosomal protein YmL20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2639 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9049
Predicted cleavage: 18
Protein family membership
- Ribosomal protein L20, mitochondrial (IPR024388)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
Protein sequence
>MCA_02122_1 MKSINSIRPLVFSRSVSSFSKKKAVPTPFPTTYHPTKSASTTKILLPTGVVHNPPASAPTPYQTPSAFLPKDDPRREAVW NTKKQDVDTMPPLNEREKKYHLTEAEIQEIQKLRLQDPETWTRKALAEKFQCSPFFISMVSTPDPARLQEMNRRLEVIKS RWTEHREIARRDRKRRREIWLRDM
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.