Protein

MCA_02094_1

Length
159 amino acids


Browser: contigB:217371-217971+

RNA-seq: read pairs 716, FPKM 55.3, percentile rank 67.5% (100% = highest expression)

Protein function

EGGNOG:0PR0WSedlin, N-terminal conserved region
CGD closest match:CAL0000200951orf19.2888Uncharacterized protein (Fragment)

Protein alignments

%idAln lengthE-value
MIA_05520_171.25%1601e-79MIA_05520_1
A0A0J9XFX8_GEOCN60.38%1592e-66Similar to Saccharomyces cerevisiae YEL048C TCA17 Subunit of TRAPPII, a multimeric GEF involved in intra-Golgi and endosome-to-Golgi transport OS=Geotrichum candidum GN=BN980_GECA12s02474g PE=4 SV=1
UniRef50_A0A0J9XFX860.38%1593e-63Similar to Saccharomyces cerevisiae YEL048C TCA17 Subunit of TRAPPII, a multimeric GEF involved in intra-Golgi and endosome-to-Golgi transport n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XFX8_GEOCN
A0A060T7B1_BLAAD53.90%1545e-54ARAD1C20042p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C20042g PE=4 SV=1
A0A1E3PGM5_9ASCO44.12%1702e-43Snare-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84049 PE=4 SV=1
Q6CFC6_YARLI34.46%1484e-19YALI0B08316p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B08316g PE=4 SV=1
A0A1E4TDG1_9ASCO30.41%1483e-15Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4405 PE=4 SV=1
A0A1D8PMJ9_CANAL25.93%1626e-08Uncharacterized protein (Fragment) OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2888 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2314
Predicted cleavage: 31

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 159

Detailed signature matches

    1. PF04628 (Sedlin_N)
    1. SSF64356 (SNARE-like)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_02094_1
MPVPIRFVSIIGSDNFPLYIRSFTSTFQDDEPQPDLTTNKELLQYHFLSHMALDYVISQLSQTESTQDYALLLVHGGIAV
FGSLTNTNVKILIGVDAQESVRADLRTTMRLIHRAYITHICNPFYDSTTSDRKPITSRMFNNSIKTIVQAWNTSAGGHM

GO term prediction

Biological Process

GO:0006810 transport
GO:0006888 ER to Golgi vesicle-mediated transport

Molecular Function

None predicted.

Cellular Component

GO:0005622 intracellular