Protein
MCA_02048_1
Length
221 amino acids
Gene name: EFB1
Description: Elongation factor 1-beta
Browser: contigB:97982-98847+
RNA-seq: read pairs 30115, FPKM 1676.1, percentile rank 97.6% (100% = highest expression)
Protein function
Annotation: | EFB1 | Elongation factor 1-beta | |
---|---|---|---|
KEGG: | K03232 | EEF1B | elongation factor 1-beta |
EGGNOG: | 0PFG8 | EFB1 | Elongation factor |
SGD closest match: | S000000003 | EFB1 | Elongation factor 1-beta |
CGD closest match: | CAL0000176377 | EFB1 | Translation elongation factor 1 subunit beta |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A060T6B1_BLAAD | 76.02% | 221 | 2e-101 | ARAD1C12606p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C12606g PE=3 SV=1 |
A0A0J9X510_GEOCN | 74.67% | 225 | 8e-99 | Similar to Saccharomyces cerevisiae YAL003W EFB1 Translation elongation factor 1 beta OS=Geotrichum candidum GN=BN980_GECA03s03145g PE=3 SV=1 |
A0A1E3PLU9_9ASCO | 70.22% | 225 | 7e-88 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82241 PE=3 SV=1 |
Q6C294_YARLI | 66.37% | 223 | 4e-79 | YALI0F09669p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F09669g PE=3 SV=1 |
UniRef50_A0A0S7E0U9 | 56.77% | 229 | 5e-72 | Elongation factor 1-beta n=5 Tax=leotiomyceta TaxID=716546 RepID=A0A0S7E0U9_9EURO |
MIA_05560_1 | 63.00% | 227 | 7e-77 | MIA_05560_1 |
A0A1D8PM35_CANAL | 65.16% | 221 | 1e-71 | Translation elongation factor 1 subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EFB1 PE=3 SV=1 |
EF1B_YEAST | 59.46% | 222 | 9e-67 | Elongation factor 1-beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFB1 PE=1 SV=4 |
A0A167FWI8_9ASCO | 67.31% | 156 | 3e-50 | Translation elongation factor 1 subunit beta OS=Sugiyamaella lignohabitans GN=EFB1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1128
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
50
100
150
221
Detailed signature matches
-
-
SSF47616 (GST C-ter...)
-
-

Unintegrated signatures
-
-
cd10308 (GST_C_eEF1...)
-
mobidb-lite (disord...)
Residue annotation
-
putative protein i...
-
putative protein i...
-
EF1A interaction s...
Protein sequence
>MCA_02048_1 MGFSDLSSAAGLKSLNTFLADKSYIEGTSPSQADVAVYKAVGSAPDAESYPNAARWYKHIASYSEEFSSLPGDKDAKASQ FGPSESAAAEEEDDEDVDLFGSDDEEDEEAERVKAERLAEYQKKKATSKPKPAAKSIVTLDVKPWDDETDMDELLANVKA INMDGLVWGGHQFIPIGYGIKKLQINCVIEDEKVSVTAIEEAIADDEDHVQSTDVAAMQKL
GO term prediction
Biological Process
GO:0006414 translational elongation
Molecular Function
GO:0003746 translation elongation factor activity
Cellular Component
GO:0005853 eukaryotic translation elongation factor 1 complex