Protein
MCA_02047_1
Length
344 amino acids
Gene name: MDM12
Description: Mitochondrial distribution and morphology protein 12, homologue in Saccharomyces cerevisiae is mitochondrial outer membrane protein and subunit of ERMES complex subunit; required for transmission of mitochondria to daughter cells.
Browser: contigB:96671-97706-
RNA-seq: read pairs 887, FPKM 31.8, percentile rank 54.3% (100% = highest expression)
Protein function
| Annotation: | MDM12 | Mitochondrial distribution and morphology protein 12, homologue in Saccharomyces cerevisiae is mitochondrial outer membrane protein and subunit of ERMES complex subunit; required for transmission of mitochondria to daughter cells. | |
|---|---|---|---|
| KEGG: | K17765 | MDM12 | mitochondrial distribution and morphology protein 12 |
| EGGNOG: | 0PI4S | MDM12 | Component of the ERMES MDM complex, which serves as a molecular tether to connect the endoplasmic reticulum and mitochondria. Components of this complex are involved in the control of mitochondrial shape and protein biogenesis and may function in phospholipid exchange. MDM12 is required for the interaction of the ER-resident membrane protein MMM1 and the outer mitochondrial membrane-resident beta-barrel protein MDM10. The MDM12-MMM1 subcomplex functions in the major beta-barrel assembly pathway that is responsible for biogenesis of all mitochondrial outer membrane beta-barrel proteins, and acts in a late step after the SAM complex. The MDM10-MDM12-MMM1 subcomplex further acts in the TOM40-specific pathway after the action of the MDM12-MMM1 complex. Essential for establishing and maintaining the structure of mitochondria and maintenance of mtDNA nucleoids (By similarity) |
| SGD closest match: | S000005369 | MDM12 | Mitochondrial distribution and morphology protein 12 |
| CGD closest match: | CAL0000201825 | MDM12 | Mitochondrial distribution and morphology protein 12 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9X7W5_GEOCN | 49.26% | 404 | 2e-101 | Mitochondrial distribution and morphology protein 12 OS=Geotrichum candidum GN=MDM12 PE=3 SV=1 |
| UniRef50_A0A0J9X7W5 | 49.26% | 404 | 4e-98 | Mitochondrial distribution and morphology protein 12 n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7W5_GEOCN |
| MIA_05561_1 | 80.00% | 135 | 1e-67 | MIA_05561_1 |
| MDM12_YARLI | 35.26% | 346 | 2e-57 | Mitochondrial distribution and morphology protein 12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDM12 PE=3 SV=1 |
| A0A167CX07_9ASCO | 54.17% | 144 | 9e-47 | Mitochondrial distribution and morphology protein 12 OS=Sugiyamaella lignohabitans GN=MDM12 PE=3 SV=1 |
| A0A060T0F2_BLAAD | 54.32% | 162 | 2e-43 | Mitochondrial distribution and morphology protein 12 OS=Blastobotrys adeninivorans GN=MDM12 PE=3 SV=1 |
| A0A1E3PRE9_9ASCO | 55.94% | 143 | 2e-41 | Mitochondrial distribution and morphology protein 12 (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_14731 PE=3 SV=1 |
| MDM12_CANAL | 42.86% | 161 | 5e-33 | Mitochondrial distribution and morphology protein 12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDM12 PE=3 SV=1 |
| A0A1E4TL15_9ASCO | 42.25% | 142 | 4e-26 | Mitochondrial distribution and morphology protein 12 OS=Tortispora caseinolytica NRRL Y-17796 GN=MDM12 PE=3 SV=1 |
| MDM12_YEAST | 39.47% | 152 | 1e-25 | Mitochondrial distribution and morphology protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM12 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0169
Protein family membership
Domains and repeats
-
Domain
1
50
100
150
200
250
300
344
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_02047_1 MSIDIDWEKLTVENDLISESIRSFLDQRFQEMKLPSFLKSISVTSFDLGNIPPKVVIQSITDPFPEFYSDEDSQADNDSA VIPIVTADPIDSETSSQHTVPPYYEVDPIINNPTTQSSSFQHLPSTLQQSMLPGIRSPIYSSVHMQSLLSGPVLPKTASG VRSKAKTTSASSSTSNLPQSEASISSSSSDYEQSTPLSNENTTPARSKNDLQVYMHVVYKGDVKVGIETTILLNYPSPNF VSLPLKLLMSGLEINSIAAVAYIEKKIHFSFICDADNEGKPVTLSGKDRVEIIKEIKIESEVGDREGNGPVLRNVGKIER FLLEKLRDLARDELAWPGWITLEL
GO term prediction
Biological Process
GO:0007005 mitochondrion organization
GO:0045040 protein import into mitochondrial outer membrane
Molecular Function
None predicted.
Cellular Component
GO:0032865 ERMES complex