Protein

MCA_02032_1

Length
433 amino acids

Gene name: VPS4

Description: Vacuolar protein sorting-associated protein 4

Browser: contigB:63943-65408-

RNA-seq: read pairs 1799, FPKM 51.2, percentile rank 65.9% (100% = highest expression)

Protein function

Annotation:VPS4Vacuolar protein sorting-associated protein 4
KEGG:K12196VPS4 vacuolar protein-sorting-associated protein 4
EGGNOG:0PG4MVPS4Vacuolar protein sorting-associated protein
SGD closest match:S000006377VPS4Vacuolar protein sorting-associated protein 4
CGD closest match:CAL0000180282VPS4Vacuolar protein sorting-associated protein 4

Protein alignments

%idAln lengthE-value
MIA_05575_178.80%4340.0MIA_05575_1
A0A0J9XC19_GEOCN71.92%4380.0Similar to Saccharomyces cerevisiae YPR173C VPS4 AAA-ATPase involved in multivesicular body (MVB) protein sorting OS=Geotrichum candidum GN=BN980_GECA09s00175g PE=3 SV=1
A0A060T4M9_BLAAD69.04%4360.0ARAD1A18964p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A18964g PE=3 SV=1
A0A1E3PSI8_9ASCO68.95%4380.0AAA-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_19983 PE=3 SV=1
VPS4_CANAL68.11%4390.0Vacuolar protein sorting-associated protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS4 PE=2 SV=1
UniRef50_P5291767.65%4390.0Vacuolar protein sorting-associated protein 4 n=535 Tax=Eukaryota TaxID=2759 RepID=VPS4_YEAST
VPS4_YEAST67.65%4390.0Vacuolar protein sorting-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS4 PE=1 SV=1
Q6CEE2_YARLI65.13%4330.0YALI0B16368p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B16368g PE=3 SV=1
A0A161HGN8_9ASCO73.58%3860.0AAA family ATPase VPS4 OS=Sugiyamaella lignohabitans GN=VPS4 PE=3 SV=1
A0A1E4TGL1_9ASCO43.16%3291e-80Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_24065 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1744

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 433

Detailed signature matches

  1. Domain IPR007330
    MIT
    1. PF04212 (MIT)
    2. SM00745 (smart)
    3. SSF116846 (MIT domain)
  2. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  3. Domain IPR003593
    AAA+ ATPase domain
    1. SM00382 (AAA_5)
  4. Domain IPR003959
    ATPase, AAA-type, core
    1. PF00004 (AAA)
  5. Domain IPR015415
    Vps4 oligomerisation, C-terminal
    1. PF09336 (Vps4_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:1.10.8.60
  3. G3DSA:1.20.58...
  4. G3DSA:3.40.50...
  5. cd00009 (AAA)
  6. mobidb-lite (disord...)

Residue annotation

  1. Walker A motif cd0...
  2. ATP binding site c...
  3. Walker B motif cd0...
  4. arginine finger cd...

Protein sequence

>MCA_02032_1
MDIFQKANAILEKAIKADNEGRYKEAYNDYINGIQYYMHIMKYEKNEDRRRIFAEKSNEYLMRAEQLKEHLDKLEDKSET
SEPSANGSTKEKKPSAENEDSESKKLRSALSSAILTEKPNVHWSDVAGLEGAKEALKEAVIMPVKFPHLFKGNRKPAAGI
LLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGESERLIKQLFNLAKEQRPSIIFIDEVDALCGPRGEGESEAS
RRIKNELLIQMNGFTGDDKGGVLVLGATNIPWQLDAAMRRRFERRVYIPLPDIEARTRMFQLNVGDTPCDLSLQDFRLLA
EMTEGYSGHDVAVSVRDALMQPIRKIQAATHFKQVTVKDPETGENRLKWTPCSPGDNGSQEMSWMDISGDELQEPPLTVK
DFFKAIKAIKPTVSKDDIQKQVEFTNEFGQEGN

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005524 ATP binding

Cellular Component

None predicted.