Protein
MCA_02030_1
Length
108 amino acids
Gene name: TIM13
Description: Mitochondrial import inner membrane translocase subunit TIM13
Browser: contigB:59850-60177-
RNA-seq: read pairs 2858, FPKM 324.0, percentile rank 92.3% (100% = highest expression)
Protein function
Annotation: | TIM13 | Mitochondrial import inner membrane translocase subunit TIM13 | |
---|---|---|---|
KEGG: | K17781 | TIM13 | mitochondrial import inner membrane translocase subunit TIM13 |
EGGNOG: | 0PS0T | TIM13 | Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins |
SGD closest match: | S000003413 | TIM13 | Mitochondrial import inner membrane translocase subunit TIM13 |
CGD closest match: | CAL0000199188 | TIM13 | Mitochondrial import inner membrane translocase subunit TIM13 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_05623_1 | 78.18% | 110 | 3e-55 | MIA_05623_1 |
A0A0J9X3K8_GEOCN | 67.86% | 112 | 1e-45 | Similar to Saccharomyces cerevisiae YGR181W TIM13 Mitochondrial intermembrane space protein, forms a complex with Tim8p that delivers a subset of hydrophobic proteins to the TIM22 complex OS=Geotrichum candidum GN=BN980_GECA01s10724g PE=3 SV=1 |
A0A060TDZ5_BLAAD | 63.55% | 107 | 1e-41 | ARAD1D11440p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D11440g PE=3 SV=1 |
UniRef50_Q75F72 | 52.38% | 105 | 1e-32 | Mitochondrial import inner membrane translocase subunit TIM13 n=6 Tax=Saccharomycetales TaxID=4892 RepID=TIM13_ASHGO |
A0A1E3PEM5_9ASCO | 51.40% | 107 | 2e-34 | Putative mitochondrial import inner membrane translocase subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83942 PE=3 SV=1 |
TIM13_YEAST | 50.48% | 105 | 1e-32 | Mitochondrial import inner membrane translocase subunit TIM13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM13 PE=1 SV=1 |
TIM13_CANAL | 61.84% | 76 | 2e-28 | Mitochondrial import inner membrane translocase subunit TIM13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM13 PE=3 SV=2 |
Q6CA05_YARLI | 57.89% | 76 | 3e-28 | YALI0D06908p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D06908g PE=3 SV=2 |
A0A1E4TFS8_9ASCO | 42.27% | 97 | 8e-24 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25083 PE=3 SV=1 |
A0A167DCN8_9ASCO | 62.50% | 56 | 1e-13 | Tim13p OS=Sugiyamaella lignohabitans GN=TIM13 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0744
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
10
20
30
40
50
60
70
80
90
100
108
Detailed signature matches

Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_02030_1 MSGLTSIFGSSGSSKTEPQSTPISQSSADIKKQIQTNISQELAIANATELVNKITENCFEKCIIKPGSVLSASEQTCTKQ CMEKYMQAWNTVSRAYISRIQQASAQGI
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.