Protein
MCA_02029_1
Length
299 amino acids
Gene name: MMM1B
Description: Maintenance of mitochondrial morphology protein 1
Browser: contigB:58667-59567-
RNA-seq: read pairs 455, FPKM 18.7, percentile rank 39.7% (100% = highest expression)
Protein function
| Annotation: | MMM1B | Maintenance of mitochondrial morphology protein 1 | |
|---|---|---|---|
| KEGG: | K17764 | MMM1 | maintenance of mitochondrial morphology protein 1 |
| EGGNOG: | 0PFB3 | MMM1 | Component of the ERMES MDM complex, which serves as a molecular tether to connect the endoplasmic reticulum and mitochondria. Components of this complex are involved in the control of mitochondrial shape and protein biogenesis and may function in phospholipid exchange. The mdm12-mmm1 subcomplex functions in the major beta-barrel assembly pathway that is responsible for biogenesis of all outer membrane beta-barrel proteins, and acts in a late step after the SAM complex. The mdm10-mdm12-mmm1 subcomplex further acts in the TOM40-specific pathway after the action of the mdm12-mmm1 complex. Essential for establishing and maintaining the structure of mitochondria and maintenance of mtDNA nucleoids (By similarity) |
| SGD closest match: | S000003929 | MMM1 | Maintenance of mitochondrial morphology protein 1 |
| CGD closest match: | CAL0000191719 | MMM1 | Maintenance of mitochondrial morphology protein 1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05622_1 | 49.46% | 370 | 4e-108 | MIA_05622_1 |
| A0A060TD74_BLAAD | 46.67% | 285 | 8e-73 | Maintenance of mitochondrial morphology protein 1 OS=Blastobotrys adeninivorans GN=MMM1 PE=3 SV=1 |
| UniRef50_A0A060TD74 | 46.67% | 285 | 2e-69 | Maintenance of mitochondrial morphology protein 1 n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A060TD74_BLAAD |
| A0A161HG52_9ASCO | 41.36% | 324 | 4e-71 | Maintenance of mitochondrial morphology protein 1 OS=Sugiyamaella lignohabitans GN=MMM1 PE=3 SV=1 |
| A0A1E3PG89_9ASCO | 40.48% | 294 | 4e-66 | Maintenance of mitochondrial morphology protein 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=MMM1 PE=3 SV=1 |
| MMM1_CANAL | 37.43% | 334 | 7e-63 | Maintenance of mitochondrial morphology protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MMM1 PE=3 SV=2 |
| MMM12_YARLI | 45.67% | 254 | 3e-60 | Maintenance of mitochondrial morphology protein 1-2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MMM1-2 PE=3 SV=1 |
| A0A1E4TEV3_9ASCO | 36.83% | 315 | 2e-56 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13135 PE=3 SV=1 |
| MMM1_YEAST | 43.48% | 230 | 2e-53 | Maintenance of mitochondrial morphology protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMM1 PE=1 SV=2 |
| A0A0J9XBE9_GEOCN | 28.65% | 178 | 1e-17 | Maintenance of mitochondrial morphology protein 1 OS=Geotrichum candidum GN=MMM1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0986
Predicted cleavage: 51
Protein family membership
Domains and repeats
-
Domain
1
50
100
150
200
250
299
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_02029_1 MNQFTTYKLAPLPLDYNSNGFLYGFIVGQVTIFLIVAVFLRFFLFSTSQKTTRNKNPQVQYSQPIDDTPINNSLILSKTS YNLHHLPESLDWFNVILAQIINQYRADAQNSRLMTWLNTVLNGQKRPDILDEIKITELNIGEDFPIFSNCKIQKVGQSSG RDAGDNLVAEMDVDLSDTITLGIETRVLLNQPKWLNISMPVSLTLSIVRFSARLRIRMLRTHEEANEKNTKLSLYLSFKP DFTLEVATRSLLGARSRLQDMPRIGHIIEGFFRKWFLDNFVEPYYREFIIMRYNISKTT
GO term prediction
Biological Process
GO:0007005 mitochondrion organization
Molecular Function
None predicted.
Cellular Component
GO:0032865 ERMES complex