Protein

MCA_02029_1

Length
299 amino acids


Gene name: MMM1B

Description: Maintenance of mitochondrial morphology protein 1

Browser: contigB:58667-59567-

RNA-seq: read pairs 455, FPKM 18.7, percentile rank 39.7% (100% = highest expression)

Protein function

Annotation:MMM1BMaintenance of mitochondrial morphology protein 1
KEGG:K17764MMM1 maintenance of mitochondrial morphology protein 1
EGGNOG:0PFB3MMM1Component of the ERMES MDM complex, which serves as a molecular tether to connect the endoplasmic reticulum and mitochondria. Components of this complex are involved in the control of mitochondrial shape and protein biogenesis and may function in phospholipid exchange. The mdm12-mmm1 subcomplex functions in the major beta-barrel assembly pathway that is responsible for biogenesis of all outer membrane beta-barrel proteins, and acts in a late step after the SAM complex. The mdm10-mdm12-mmm1 subcomplex further acts in the TOM40-specific pathway after the action of the mdm12-mmm1 complex. Essential for establishing and maintaining the structure of mitochondria and maintenance of mtDNA nucleoids (By similarity)
SGD closest match:S000003929MMM1Maintenance of mitochondrial morphology protein 1
CGD closest match:CAL0000191719MMM1Maintenance of mitochondrial morphology protein 1

Protein alignments

%idAln lengthE-value
MIA_05622_149.46%3704e-108MIA_05622_1
A0A060TD74_BLAAD46.67%2858e-73Maintenance of mitochondrial morphology protein 1 OS=Blastobotrys adeninivorans GN=MMM1 PE=3 SV=1
UniRef50_A0A060TD7446.67%2852e-69Maintenance of mitochondrial morphology protein 1 n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A060TD74_BLAAD
A0A161HG52_9ASCO41.36%3244e-71Maintenance of mitochondrial morphology protein 1 OS=Sugiyamaella lignohabitans GN=MMM1 PE=3 SV=1
A0A1E3PG89_9ASCO40.48%2944e-66Maintenance of mitochondrial morphology protein 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=MMM1 PE=3 SV=1
MMM1_CANAL37.43%3347e-63Maintenance of mitochondrial morphology protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MMM1 PE=3 SV=2
MMM12_YARLI45.67%2543e-60Maintenance of mitochondrial morphology protein 1-2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MMM1-2 PE=3 SV=1
A0A1E4TEV3_9ASCO36.83%3152e-56Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13135 PE=3 SV=1
MMM1_YEAST43.48%2302e-53Maintenance of mitochondrial morphology protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMM1 PE=1 SV=2
A0A0J9XBE9_GEOCN28.65%1781e-17Maintenance of mitochondrial morphology protein 1 OS=Geotrichum candidum GN=MMM1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0986
Predicted cleavage: 51

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 299

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_02029_1
MNQFTTYKLAPLPLDYNSNGFLYGFIVGQVTIFLIVAVFLRFFLFSTSQKTTRNKNPQVQYSQPIDDTPINNSLILSKTS
YNLHHLPESLDWFNVILAQIINQYRADAQNSRLMTWLNTVLNGQKRPDILDEIKITELNIGEDFPIFSNCKIQKVGQSSG
RDAGDNLVAEMDVDLSDTITLGIETRVLLNQPKWLNISMPVSLTLSIVRFSARLRIRMLRTHEEANEKNTKLSLYLSFKP
DFTLEVATRSLLGARSRLQDMPRIGHIIEGFFRKWFLDNFVEPYYREFIIMRYNISKTT

GO term prediction

Biological Process

GO:0007005 mitochondrion organization

Molecular Function

None predicted.

Cellular Component

GO:0032865 ERMES complex