Protein

MCA_02025_2

Length
66 amino acids

Gene name: QCR9

Description: Cytochrome b-c1 complex subunit 9

Browser: contigB:52919-53348-

RNA-seq: read pairs 16807, FPKM 3099.5, percentile rank 98.5% (100% = highest expression)

Protein function

Annotation:QCR9Cytochrome b-c1 complex subunit 9
KEGG:K00419QCR9 ubiquinol-cytochrome c reductase subunit 9
EGGNOG:0PTB6Ubiquinol-cytochrome C reductase
SGD closest match:S000003415QCR9Cytochrome b-c1 complex subunit 9

Protein alignments

%idAln lengthE-value
A0A0J9XJL8_GEOCN73.44%643e-23Similar to Saccharomyces cerevisiae YGR183C QCR9 Subunit 9 of the ubiquinol cytochrome-c reductase complex,which is a component of the mitochondrial inner membrane electron transport chain OS=Geotrichum candidum GN=BN980_GECA22s01539g PE=4 SV=1
UniRef50_Q5KCZ357.58%667e-15Ubiquinol-cytochrome c reductase complex 7.3 kDa protein, putative n=48 Tax=Fungi TaxID=4751 RepID=Q5KCZ3_CRYNJ
A0A060T5W6_BLAAD57.14%632e-17ARAD1B14938p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B14938g PE=4 SV=1
A0A1E3PMS1_9ASCO67.86%567e-17Ubiquinol-cytochrome C reductase (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_22808 PE=4 SV=1
Q6CG23_YARLI55.74%616e-15YALI0B01540p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B01540g PE=4 SV=1
QCR9_YEAST42.00%501e-06Cytochrome b-c1 complex subunit 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR9 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8896
Predicted cleavage: 17

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR008027
    Cytochrome b-c1 complex subunit 9
    1. PF05365 (UCR_UQCRX_...)
    2. SSF81514 (Subunit X...)
    3. G3DSA:1.20.5.260
Unintegrated signatures no IPR
Unintegrated signatures
  1. NON_CYTOPLASM... (N...)
  2. SIGNAL_PEPTIDE (Sig...)
  3. SIGNAL_PEPTID... (S...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)
  6. TMhelix

Protein sequence

>MCA_02025_2
MAGFSTFIYNTLFRRNSVFVGSVFAAAFFFDAGYSKAVDIYFDKINAGKQWKDIRHKYVESEDDEE

GO term prediction

Biological Process

GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c

Molecular Function

None predicted.

Cellular Component

GO:0005743 mitochondrial inner membrane
GO:0005750 mitochondrial respiratory chain complex III