Protein
MCA_02025_2
Length
66 amino acids
Gene name: QCR9
Description: Cytochrome b-c1 complex subunit 9
Browser: contigB:52919-53348-
RNA-seq: read pairs 16807, FPKM 3099.5, percentile rank 98.5% (100% = highest expression)
Protein function
Annotation: | QCR9 | Cytochrome b-c1 complex subunit 9 | |
---|---|---|---|
KEGG: | K00419 | QCR9 | ubiquinol-cytochrome c reductase subunit 9 |
EGGNOG: | 0PTB6 | Ubiquinol-cytochrome C reductase | |
SGD closest match: | S000003415 | QCR9 | Cytochrome b-c1 complex subunit 9 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XJL8_GEOCN | 73.44% | 64 | 3e-23 | Similar to Saccharomyces cerevisiae YGR183C QCR9 Subunit 9 of the ubiquinol cytochrome-c reductase complex,which is a component of the mitochondrial inner membrane electron transport chain OS=Geotrichum candidum GN=BN980_GECA22s01539g PE=4 SV=1 |
UniRef50_Q5KCZ3 | 57.58% | 66 | 7e-15 | Ubiquinol-cytochrome c reductase complex 7.3 kDa protein, putative n=48 Tax=Fungi TaxID=4751 RepID=Q5KCZ3_CRYNJ |
A0A060T5W6_BLAAD | 57.14% | 63 | 2e-17 | ARAD1B14938p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B14938g PE=4 SV=1 |
A0A1E3PMS1_9ASCO | 67.86% | 56 | 7e-17 | Ubiquinol-cytochrome C reductase (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_22808 PE=4 SV=1 |
Q6CG23_YARLI | 55.74% | 61 | 6e-15 | YALI0B01540p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B01540g PE=4 SV=1 |
QCR9_YEAST | 42.00% | 50 | 1e-06 | Cytochrome b-c1 complex subunit 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR9 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8896
Predicted cleavage: 17
Protein family membership
- Cytochrome b-c1 complex subunit 9 (IPR008027)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
NON_CYTOPLASM... (N...)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
Protein sequence
>MCA_02025_2 MAGFSTFIYNTLFRRNSVFVGSVFAAAFFFDAGYSKAVDIYFDKINAGKQWKDIRHKYVESEDDEE
GO term prediction
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
Molecular Function
None predicted.
Cellular Component
GO:0005743 mitochondrial inner membrane
GO:0005750 mitochondrial respiratory chain complex III