Protein

MCA_02006_1

Length
222 amino acids

Gene name: RPL10

Description: 60S ribosomal protein L10

Browser: contigB:20433-21102-

RNA-seq: read pairs 108338, FPKM 6002.8, percentile rank 99.8% (100% = highest expression)

Protein function

Annotation:RPL1060S ribosomal protein L10
KEGG:K02866RP-L10e large subunit ribosomal protein L10e
EGGNOG:0PH0MFG10246.160s ribosomal protein L10
SGD closest match:S000004065RPL1060S ribosomal protein L10
CGD closest match:CAL0000194016RPL10Ribosomal 60S subunit protein L10

Protein alignments

%idAln lengthE-value
MIA_05597_191.44%2223e-137MIA_05597_1
A0A060TBH4_BLAAD88.74%2222e-134ARAD1B07678p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B07678g PE=4 SV=1
A0A167CD93_9ASCO88.74%2226e-134Ribosomal 60S subunit protein L10 OS=Sugiyamaella lignohabitans GN=RPL10 PE=4 SV=1
A0A0J9XD06_GEOCN87.84%2225e-132Similar to Saccharomyces cerevisiae YLR075W RPL10 Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA08s03310g PE=4 SV=1
A0A1E3PQE0_9ASCO84.72%2168e-125Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81671 PE=4 SV=1
Q5AIB8_CANAL84.26%2161e-124Ribosomal 60S subunit protein L10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL10 PE=4 SV=1
RL10_YEAST83.33%2161e-12360S ribosomal protein L10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL10 PE=1 SV=1
UniRef50_P4180583.33%2164e-12060S ribosomal protein L10 n=252 Tax=Eukaryota TaxID=2759 RepID=RL10_YEAST
Q6C986_YARLI82.95%2173e-123YALI0D13104p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D13104g PE=4 SV=1
A0A1E4TLN5_9ASCO80.84%2143e-119Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_90082 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9488
Predicted cleavage: 26

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 222

Detailed signature matches

  1. Family IPR001197
    Ribosomal protein L10e
    1. PIRSF005590 (RPL10a...)
    2. TIGR00279
  2. Domain IPR016180
    Ribosomal protein L10e/L16
    1. SSF54686 (Ribosomal...)
    2. cd01433 (Ribosomal_...)
    3. PF00252 (Ribosomal_L16)
    4. G3DSA:3.90.11...
  3. SITE IPR018255
    Ribosomal protein L10e, conserved site
    1. PS01257 (RIBOSOMAL_...)

Residue annotation

  1. 23S rRNA interface...
  2. 5S rRNA interface ...
  3. putative antibioti...
  4. L25 interface cd01...
  5. L27 interface cd01...

Protein sequence

>MCA_02006_1
MARRPARCYRYCKNKPFPKSRYNRGVPDAKIRIYDLGRKRAVVDDFPLCVHLVSNELEQLSSEALEAARICANKYITKVS
GRESFHLRIRVHPFHVLRINKMLSCAGADRLQQGMRGAWGKPAGLAARVNIGQIIISVRTRDSNKAVVIEGLRRARYKFP
GQQKIIISKKWGFTNLDRDVYVARRERGEIKDDGAFVKFHNKKGNLEEAVYGFPQYNPEVSA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome