Protein
MCA_02006_1
Length
222 amino acids
Gene name: RPL10
Description: 60S ribosomal protein L10
Browser: contigB:20433-21102-
RNA-seq: read pairs 108338, FPKM 6002.8, percentile rank 99.8% (100% = highest expression)
Protein function
| Annotation: | RPL10 | 60S ribosomal protein L10 | |
|---|---|---|---|
| KEGG: | K02866 | RP-L10e | large subunit ribosomal protein L10e |
| EGGNOG: | 0PH0M | FG10246.1 | 60s ribosomal protein L10 |
| SGD closest match: | S000004065 | RPL10 | 60S ribosomal protein L10 |
| CGD closest match: | CAL0000194016 | RPL10 | Ribosomal 60S subunit protein L10 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05597_1 | 91.44% | 222 | 3e-137 | MIA_05597_1 |
| A0A060TBH4_BLAAD | 88.74% | 222 | 2e-134 | ARAD1B07678p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B07678g PE=4 SV=1 |
| A0A167CD93_9ASCO | 88.74% | 222 | 6e-134 | Ribosomal 60S subunit protein L10 OS=Sugiyamaella lignohabitans GN=RPL10 PE=4 SV=1 |
| A0A0J9XD06_GEOCN | 87.84% | 222 | 5e-132 | Similar to Saccharomyces cerevisiae YLR075W RPL10 Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA08s03310g PE=4 SV=1 |
| A0A1E3PQE0_9ASCO | 84.72% | 216 | 8e-125 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81671 PE=4 SV=1 |
| Q5AIB8_CANAL | 84.26% | 216 | 1e-124 | Ribosomal 60S subunit protein L10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL10 PE=4 SV=1 |
| RL10_YEAST | 83.33% | 216 | 1e-123 | 60S ribosomal protein L10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL10 PE=1 SV=1 |
| UniRef50_P41805 | 83.33% | 216 | 4e-120 | 60S ribosomal protein L10 n=252 Tax=Eukaryota TaxID=2759 RepID=RL10_YEAST |
| Q6C986_YARLI | 82.95% | 217 | 3e-123 | YALI0D13104p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D13104g PE=4 SV=1 |
| A0A1E4TLN5_9ASCO | 80.84% | 214 | 3e-119 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_90082 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9488
Predicted cleavage: 26
Protein family membership
- Ribosomal protein L10e (IPR001197)
Domains and repeats
-
Domain
1
50
100
150
222
Detailed signature matches
-
-
PIRSF005590 (RPL10a...)
-
-
-
-
-
PS01257 (RIBOSOMAL_...)
-
Residue annotation
-
23S rRNA interface...
-
5S rRNA interface ...
-
putative antibioti...
-
L25 interface cd01...
-
L27 interface cd01...
Protein sequence
>MCA_02006_1 MARRPARCYRYCKNKPFPKSRYNRGVPDAKIRIYDLGRKRAVVDDFPLCVHLVSNELEQLSSEALEAARICANKYITKVS GRESFHLRIRVHPFHVLRINKMLSCAGADRLQQGMRGAWGKPAGLAARVNIGQIIISVRTRDSNKAVVIEGLRRARYKFP GQQKIIISKKWGFTNLDRDVYVARRERGEIKDDGAFVKFHNKKGNLEEAVYGFPQYNPEVSA
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome