Protein
MCA_02004_1
Length
204 amino acids
Gene name: FMP32
Description: Putative assembly factor for cytochrome c oxidase; non-tagged protein is detected in highly purified mitochondria in high-throughput studies
Browser: contigB:18412-19027+
RNA-seq: read pairs 1177, FPKM 70.9, percentile rank 73.0% (100% = highest expression)
Protein function
| Annotation: | FMP32 | Putative assembly factor for cytochrome c oxidase; non-tagged protein is detected in highly purified mitochondria in high-throughput studies | |
|---|---|---|---|
| EGGNOG: | 0PINJ | PGUG_01174 | Mitochondrial protein |
| SGD closest match: | S000001848 | FMP32 | Protein FMP32, mitochondrial |
| CGD closest match: | CAL0000177185 | orf19.2939 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05595_1 | 84.95% | 186 | 1e-112 | MIA_05595_1 |
| A0A0J9XB74_GEOCN | 78.46% | 195 | 5e-109 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA08s03288g PE=4 SV=1 |
| A0A167E559_9ASCO | 65.17% | 201 | 3e-90 | Fmp32p OS=Sugiyamaella lignohabitans GN=FMP32 PE=4 SV=1 |
| A0A060T628_BLAAD | 68.93% | 177 | 3e-86 | ARAD1B07722p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B07722g PE=4 SV=1 |
| A0A1E3PMY8_9ASCO | 64.02% | 189 | 8e-82 | DUF1640-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82514 PE=4 SV=1 |
| UniRef50_K0KBM4 | 53.92% | 204 | 5e-73 | Coiled-coil domain-containing protein n=26 Tax=Ascomycota TaxID=4890 RepID=K0KBM4_WICCF |
| Q6C984_YARLI | 51.96% | 179 | 1e-66 | YALI0D13134p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D13134g PE=4 SV=1 |
| Q5AIB4_CANAL | 52.87% | 174 | 2e-60 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2939 PE=4 SV=1 |
| FMP32_YEAST | 47.31% | 167 | 8e-52 | Protein FMP32, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP32 PE=1 SV=1 |
| A0A1E4TFC7_9ASCO | 22.93% | 157 | 8e-07 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_11554 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9140
Protein family membership
- Coiled-coil domain-containing protein 90-like (IPR024461)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_02004_1 MFRSGFRRFLNFQTSQFHTSTAHLKQFHFDTRKFVIRLERQGFSAVQSEAVLKAITTVLDDGIDNLQQNLVSKEEFSRKS YQQKVDFAKLRSELQTLDKTDASRIATENERLKTDIDKLRQKFKEEIAKQQASVRLDINLEKGRIREESAKQELKIAEIR SRIDQEMSNFKTQIGATKLQVVQWLIGVCTGAFAVVLAYIRLLS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.