Protein

MCA_02000_1

Length
185 amino acids


Gene name: NUO1

Description: NADH-ubiquinone oxidoreductase subunit

Browser: contigB:13736-14358-

RNA-seq: read pairs 15755, FPKM 1046.6, percentile rank 96.7% (100% = highest expression)

Protein function

Annotation:NUO1NADH-ubiquinone oxidoreductase subunit
EGGNOG:0PIMMNADH-ubiquinone oxidoreductase 21 kDa subunit
CGD closest match:CAL0000193252NUO1Nuo1p

Protein alignments

%idAln lengthE-value
MIA_05589_181.08%1853e-115MIA_05589_1
A0A0J9XDE4_GEOCN75.14%1853e-107NUXM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA10s02782g PE=4 SV=1
A0A167CHA4_9ASCO59.89%1822e-74Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_4516 PE=4 SV=1
UniRef50_A0A167CHA459.89%1825e-71Uncharacterized protein n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A167CHA4_9ASCO
A0A060T4U9_BLAAD55.25%1811e-68ARAD1C44396p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C44396g PE=4 SV=1
A0A1E4THG9_9ASCO54.71%1701e-63Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_17689 PE=4 SV=1
A0A1D8PU10_CANAL51.12%1786e-56Nuo1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NUO1 PE=4 SV=1
Q6C4A6_YARLI47.06%1535e-42YALI0E28424p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E28424g PE=4 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0271

Protein family membership

None predicted.

Domains and repeats

1 20 40 60 80 100 120 140 160 185

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_02000_1
MSEFKNTTPAKGEYELIDIDPHFTKVVKYFRGSDYLRWALFTASAPMFLYWSEHIQSEGKSRKVSPRTLRIAAMIGFTSG
FIFSYNRSVQRFQGLTENSREVSKDRYEVKSRLANGLLPYGETDLPPWIQRVAARNSTYSSTFNHVFPWFNFVHHQYHGV
DLKKYYEVREGEEKWGFDLKMPSEN

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.