Protein
MCA_01983_1
Length
97 amino acids
Gene name: MRPL44
Description: 54S ribosomal protein L44, mitochondrial
Browser: contigA:6026291-6026735+
RNA-seq: read pairs 2329, FPKM 293.6, percentile rank 91.7% (100% = highest expression)
Protein function
Annotation: | MRPL44 | 54S ribosomal protein L44, mitochondrial | |
---|---|---|---|
KEGG: | K17434 | MRPL53 | large subunit ribosomal protein L53 |
EGGNOG: | 0PQWA | MRPL44 | mitochondrial 54S ribosomal protein YmL44 |
SGD closest match: | S000004838 | MRPL44 | 54S ribosomal protein L44, mitochondrial |
CGD closest match: | CAL0000179151 | CAALFM_CR05150WA | Mitochondrial 54S ribosomal protein YmL44 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_05679_1 | 68.93% | 103 | 3e-41 | MIA_05679_1 |
A0A0J9XCN0_GEOCN | 63.92% | 97 | 2e-40 | Similar to Saccharomyces cerevisiae YMR225C MRPL44 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA09s02606g PE=4 SV=1 |
UniRef50_A0A0J9XCN0 | 63.92% | 97 | 4e-37 | Similar to Saccharomyces cerevisiae YMR225C MRPL44 Mitochondrial ribosomal protein of the large subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XCN0_GEOCN |
A0A060T7Y0_BLAAD | 47.42% | 97 | 2e-27 | ARAD1C25520p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25520g PE=4 SV=1 |
A0A1E3PK00_9ASCO | 42.55% | 94 | 2e-23 | Mitochondrial ribosomal protein l44 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82665 PE=4 SV=1 |
RM44_YEAST | 43.01% | 93 | 1e-20 | 54S ribosomal protein L44, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL44 PE=1 SV=1 |
A0A1E4TEL6_9ASCO | 35.79% | 95 | 1e-16 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_24445 PE=4 SV=1 |
A0A1D8PSW9_CANAL | 36.46% | 96 | 3e-13 | Mitochondrial 54S ribosomal protein YmL44 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR05150WA PE=4 SV=1 |
B5RSM3_YARLI | 30.53% | 95 | 6e-12 | YALI0F29678p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F29678g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8816
Protein family membership
- Ribosomal protein L53, mitochondrial (IPR019716)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MCA_01983_1 MITKFFSKVLVAFNPLNPASKPARVFLSNIPPLQRNSIEVTQKILSPSSTEHAVISVTYNDGKTISVDPTHGSTNEIKET FDRYSRTLKLKQDMSDE
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.