Protein
MCA_01956_1
Length
201 amino acids
Browser: contigA:5969705-5970397-
RNA-seq: read pairs 1364, FPKM 83.4, percentile rank 75.9% (100% = highest expression)
Protein function
EGGNOG: | 0PNJT | FG09736.1 | ER membrane DUF1077 domain protein |
---|---|---|---|
SGD closest match: | S000003200 | EMC4 | ER membrane protein complex subunit 4 |
CGD closest match: | CAL0000180939 | orf19.7183 | ER membrane protein complex subunit 4 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_06320_1 | 54.36% | 195 | 1e-75 | MIA_06320_1 |
A0A0J9X3D3_GEOCN | 41.03% | 195 | 1e-48 | ER membrane protein complex subunit 4 OS=Geotrichum candidum GN=BN980_GECA01s09305g PE=3 SV=1 |
UniRef50_A0A0J9X3D3 | 41.03% | 195 | 2e-45 | ER membrane protein complex subunit 4 n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X3D3_GEOCN |
A0A060TCY0_BLAAD | 40.31% | 191 | 4e-36 | ER membrane protein complex subunit 4 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B19360g PE=3 SV=1 |
A0A1E3PJG4_9ASCO | 39.50% | 200 | 1e-35 | DUF1077-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50853 PE=4 SV=1 |
Q6CHC4_YARLI | 41.55% | 142 | 1e-34 | ER membrane protein complex subunit 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A10274g PE=3 SV=1 |
A0A1D8PRI7_CANAL | 39.84% | 128 | 2e-26 | ER membrane protein complex subunit 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.7183 PE=3 SV=1 |
A0A1E4TLB6_9ASCO | 31.11% | 180 | 2e-23 | ER membrane protein complex subunit 4 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_22594 PE=3 SV=1 |
EMC4_YEAST | 29.55% | 176 | 7e-20 | ER membrane protein complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC4 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0611
Protein family membership
- Protein of unknown function DUF1077, TMEM85 (IPR009445)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_01956_1 MTLSTETSVKPKWYHDLTSPLDTKLTSQSSASSDLIKVSGKIAEPSGFFFDQPSGQQEQITPSIQLHNKRELAKKQKETD DLKIRRARELSFAPAKGLLPNLLMSYFSGSSLQVLTLTMTWMMFFNGPITQIISVSDQFAKFETESNKTNIFVFKAIFCF FQTITMCVGIYKLSSMGILPNTASDWVAWEVPSKVREMSFL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.