Protein

MCA_01918_1

Length
406 amino acids


Browser: contigA:5870706-5871927-

RNA-seq: read pairs 31351, FPKM 951.8, percentile rank 96.4% (100% = highest expression)

Protein function

KEGG:K03233EEF1G elongation factor 1-gamma
EGGNOG:0PH8QFG07401.1elongation factor 1 gamma domain-containing protein
SGD closest match:S000005969CAM1Elongation factor 1-gamma 1
CGD closest match:CAL0000179576CAM1Translation elongation factor EF1B gamma

Protein alignments

%idAln lengthE-value
MIA_02255_158.19%4092e-146MIA_02255_1
A0A0J9XGE5_GEOCN55.64%4087e-138Similar to Saccharomyces cerevisiae YPL048W CAM1 Nuclear protein required for transcription of MXR1 OS=Geotrichum candidum GN=BN980_GECA15s01737g PE=4 SV=1
A0A1E3PSD9_9ASCO49.52%4165e-124EEF1-gamma domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48815 PE=4 SV=1
A0A1D8PKC3_CANAL51.20%4162e-121Translation elongation factor EF1B gamma OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAM1 PE=4 SV=1
Q6CAT7_YARLI50.49%4089e-117YALI0C24420p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C24420g PE=4 SV=1
A0A060TDM7_BLAAD51.21%4124e-115ARAD1D45276p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D45276g PE=4 SV=1
UniRef50_G8ZNS448.94%4236e-109Uncharacterized protein n=370 Tax=Eukaryota TaxID=2759 RepID=G8ZNS4_TORDC
EF1G1_YEAST48.69%4199e-112Elongation factor 1-gamma 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAM1 PE=1 SV=2
A0A161HK62_9ASCO59.62%3174e-110Cam1p OS=Sugiyamaella lignohabitans GN=CAM1 PE=4 SV=1
A0A1E4TD33_9ASCO46.17%4186e-106Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_141630 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3604
Predicted cleavage: 15

Protein family membership

None predicted.

Domains and repeats

1 50 100 150 200 250 300 350 406

Detailed signature matches

    1. SSF52833 (Thioredox...)
    1. PF02798 (GST_N)
    2. PS50404 (GST_NTER)
    1. SSF47616 (GST C-ter...)
    2. PS50405 (GST_CTER)
    1. PF00043 (GST_C)
    1. PS50040 (EF1G_C)
    2. PF00647 (EF1G)
    3. SSF89942 (eEF1-gamm...)
    4. SM01183 (EF1G_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SFLDG01156 (Main.7_)
  2. cd03181 (GST_C_EF1B...)
  3. mobidb-lite (disord...)

Residue annotation

  1. putative dimer int...
  2. N-terminal domain ...

Protein sequence

>MCA_01918_1
MSLGTVYHRNTGRETGLRAIAQALDVDVKFSEPEADFNKKFPLGKVPAFESADGKYLLHETAAIALYLALKSKTPEAAGT
TAEEKAAAAKWTYFSQGELIDALVNAIFPLLGNEKFPYNKKKVEDNTKLCNKYADVFEAYLTKNTFLVNERITIADYVVA
SVFAFGFGYIWDKAWIKQHPAVTRFFNTVIASKGYSGIIPSPFPFKEEAIKYTPPKKEPKKKAEEPKKAEKPAADAEEPP
KEKKAAHPLASLPAPKMALDEWKRVYSNKETREEALPWFWEHYDPSEYSLYKVAYKYNDELKLTFMSNNLVGGFFNRLSA
STKYLFGCLVVYGENNNNGIEGVFLVRGQDYEPAFDVAPDWESYEFTKLDASKPEDKEYVEDMWSWDKPVIVNGEKREIA
DGKVFK

GO term prediction

Biological Process

GO:0006414 translational elongation

Molecular Function

GO:0003746 translation elongation factor activity
GO:0005515 protein binding

Cellular Component

None predicted.