Protein
MCA_01865_1
Length
138 amino acids
Gene name: GOT1
Description: Protein transport protein GOT1
Browser: contigA:5722074-5722931-
RNA-seq: read pairs 1192, FPKM 106.0, percentile rank 79.7% (100% = highest expression)
Protein function
| Annotation: | GOT1 | Protein transport protein GOT1 | |
|---|---|---|---|
| EGGNOG: | 0PPQI | GOT1 | Got1 family |
| SGD closest match: | S000004906 | GOT1 | Protein transport protein GOT1 |
| CGD closest match: | CAL0000176610 | orf19.3972 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A1E3PMP3_9ASCO | 68.12% | 138 | 4e-52 | Got1-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50486 PE=4 SV=1 |
| UniRef50_A3LNQ9 | 67.39% | 138 | 1e-47 | Golgi Transport n=47 Tax=Saccharomycetales TaxID=4892 RepID=A3LNQ9_PICST |
| A0A0J9XDV5_GEOCN | 68.57% | 140 | 2e-50 | Similar to Saccharomyces cerevisiae YMR292W GOT1 Homodimeric protein that is packaged into COPII vesicles and cycles between the ER and Golgi OS=Geotrichum candidum GN=BN980_GECA11s01517g PE=4 SV=1 |
| Q6CFG5_YARLI | 65.93% | 135 | 4e-49 | YALI0B07205p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B07205g PE=4 SV=2 |
| MIA_02414_1 | 76.32% | 114 | 4e-47 | MIA_02414_1 |
| A0A1D8PP29_CANAL | 66.19% | 139 | 1e-45 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3972 PE=4 SV=1 |
| A0A060T9P8_BLAAD | 69.11% | 123 | 2e-44 | ARAD1C39380p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C39380g PE=4 SV=1 |
| GOT1_YEAST | 62.32% | 138 | 3e-39 | Protein transport protein GOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GOT1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1763
Predicted cleavage: 67
Protein family membership
- Vesicle transport protein, Got1/SFT2-like (IPR007305)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_01865_1 MWLSELQKYGVGITAVGVFFFGLGVITFFDSKLLAFGNILFILGISLIIGPQRTIYFFIRPNKIRGSVCFVFGVFLILIK YSFIGFAIECVGILSLFGDFFGVIISFLRSLPVIGTLLSNPYIAPTIDRIAGVRVLPV
GO term prediction
Biological Process
GO:0016192 vesicle-mediated transport
Molecular Function
None predicted.
Cellular Component
None predicted.