Protein

MCA_01838_1

Length
313 amino acids

Gene name: MRP1

Description: 37S ribosomal protein MRP1, mitochondrial

Browser: contigA:5623357-5624299-

RNA-seq: read pairs 4073, FPKM 160.3, percentile rank 85.6% (100% = highest expression)

Protein function

Annotation:MRP137S ribosomal protein MRP1, mitochondrial
KEGG:K04564SOD2 superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
EGGNOG:0PI01PGUG_00641mitochondrial 37S ribosomal protein MRP1
SGD closest match:S000002755MRP137S ribosomal protein MRP1, mitochondrial
CGD closest match:CAL0000186555orf19.3938Mitochondrial 37S ribosomal protein RSM26

Protein alignments

%idAln lengthE-value
A0A0J9X2G1_GEOCN36.33%3115e-54Similar to Saccharomyces cerevisiae YDR347W MRP1 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA01s01132g PE=4 SV=1
UniRef50_A0A0J9X2G136.33%3119e-51Similar to Saccharomyces cerevisiae YDR347W MRP1 Mitochondrial ribosomal protein of the small subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X2G1_GEOCN
MIA_03617_132.65%3403e-46MIA_03617_1
A0A060TC75_BLAAD34.16%3221e-43ARAD1B14542p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B14542g PE=4 SV=1
A0A1E3PQ53_9ASCO31.71%3284e-41Manganese and iron superoxide dismutase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82011 PE=4 SV=1
A0A167FX55_9ASCO30.65%3104e-31Mitochondrial 37S ribosomal protein MRP1 OS=Sugiyamaella lignohabitans GN=MRP1 PE=4 SV=1
A0A1E4TM31_9ASCO28.34%3143e-30Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30851 PE=4 SV=1
Q6CDZ0_YARLI28.35%3282e-29YALI0B20086p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B20086g PE=4 SV=1
RT01_YEAST27.39%3037e-2237S ribosomal protein MRP1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP1 PE=1 SV=2
Q5AK82_CANAL28.38%3032e-21Mitochondrial 37S ribosomal protein RSM26 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3938 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9984

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 313

Detailed signature matches

  1. Domain IPR019831
    Manganese/iron superoxide dismutase, N-terminal
    1. SSF46609 (Fe,Mn sup...)
  2. Domain IPR019832
    Manganese/iron superoxide dismutase, C-terminal
    1. PF02777 (Sod_Fe_C)
    2. SSF54719 (Fe,Mn sup...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil

Protein sequence

>MCA_01838_1
MIRSSFARLPSTTSRLFKRTLFTVPQLSTISTSETVGLPGLYSAEGLKATWTDYQKHLVQQLNESLPQQDKDMDNLEDII
LQHKALGNVISKDIAFYACQTWNNEFFMRGLLARSRNHENANISKAPREELYRDVDISTTSGPEVYPPKYELSENSTNYD
TFSTAVAKSFGSFTALKELLLAQSESILGDGYTWLVFASFGEGQKALKVMNTYSWGVPPIFSVKQLQEFEQSSRPAQLLT
EGQQSHPNNLQLEQSTLLNVAEKVTPLLNLNVWQHAYVPDYGVFGKRRYLENLWDTINWEVVCNRFAEANTRS

GO term prediction

Biological Process

GO:0006801 superoxide metabolic process
GO:0055114 oxidation-reduction process

Molecular Function

GO:0004784 superoxide dismutase activity
GO:0046872 metal ion binding

Cellular Component

None predicted.