Protein
MCA_01821_2
Length
88 amino acids
Browser: contigA:5559627-5560271-
RNA-seq: read pairs 13361, FPKM 1696.1, percentile rank 97.6% (100% = highest expression)
Protein function
| KEGG: | K22255 | ATPIF1 | ATPase inhibitor, mitochondrial |
|---|---|---|---|
| EGGNOG: | 0PSBS | negative regulation of ATPase activity | |
| SGD closest match: | S000002340 | INH1 | ATPase inhibitor, mitochondrial |
| CGD closest match: | CAL0000190017 | orf19.5201.1 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02369_1 | 84.81% | 79 | 5e-43 | MIA_02369_1 |
| A0A0J9XAG7_GEOCN | 66.67% | 84 | 8e-35 | Similar to Saccharomyces cerevisiae YDL130W-A STF1 Protein involved in regulation of the mitochondrial F1F0-ATP synthase OS=Geotrichum candidum GN=BN980_GECA07s00296g PE=4 SV=1 |
| A0A1E3PSK4_9ASCO | 52.33% | 86 | 1e-24 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_68527 PE=4 SV=1 |
| UniRef50_F2QP42 | 54.17% | 72 | 3e-20 | F1F0-ATP synthase inhibitor n=3 Tax=Saccharomycetales TaxID=4892 RepID=F2QP42_KOMPC |
| ATIF_YEAST | 51.76% | 85 | 4e-22 | ATPase inhibitor, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INH1 PE=1 SV=2 |
| Q6CCY1_YARLI | 53.75% | 80 | 7e-22 | YALI0C05621p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C05621g PE=4 SV=1 |
| A0A060T7T5_BLAAD | 43.68% | 87 | 1e-15 | ARAD1D02090p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D02090g PE=4 SV=1 |
| A0A1E4TFL1_9ASCO | 61.90% | 63 | 1e-15 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2291 PE=4 SV=1 |
| A0A1D8PD97_CANAL | 39.08% | 87 | 6e-10 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5201.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9940
Predicted cleavage: 14
Protein family membership
- Mitochondrial ATPase inhibitor (IPR007648)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
-
-
SSF64602 (F1 ATPase...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_01821_2 MLSRAITRRSVQSSISAVRFYTEGATGAPRPMGSNDSFNKREKAQEDLYVRAVEKEKLAKLRESLKKQREHLDEVEKHLD QMEKDAKN
GO term prediction
Biological Process
GO:0032780 negative regulation of ATPase activity
Molecular Function
GO:0042030 ATPase inhibitor activity
Cellular Component
GO:0005739 mitochondrion