Protein

MCA_01821_1

Length
86 amino acids


Browser: contigA:5559480-5560271-

RNA-seq: read pairs 13361, FPKM 1696.1, percentile rank 97.6% (100% = highest expression)

Protein function

EGGNOG:0PSBSnegative regulation of ATPase activity
SGD closest match:S000002340INH1ATPase inhibitor, mitochondrial
CGD closest match:CAL0000190017orf19.5201.1Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_02369_184.81%797e-43MIA_02369_1
A0A0J9XAG7_GEOCN65.48%841e-33Similar to Saccharomyces cerevisiae YDL130W-A STF1 Protein involved in regulation of the mitochondrial F1F0-ATP synthase OS=Geotrichum candidum GN=BN980_GECA07s00296g PE=4 SV=1
A0A1E3PSK4_9ASCO52.27%884e-25Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_68527 PE=4 SV=1
UniRef50_F2QP4253.33%751e-20F1F0-ATP synthase inhibitor n=3 Tax=Saccharomycetales TaxID=4892 RepID=F2QP42_KOMPC
Q6CCY1_YARLI53.09%815e-22YALI0C05621p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C05621g PE=4 SV=1
ATIF_YEAST50.60%832e-21ATPase inhibitor, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INH1 PE=1 SV=2
A0A060T7T5_BLAAD43.18%886e-16ARAD1D02090p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D02090g PE=4 SV=1
A0A1E4TFL1_9ASCO61.90%634e-15Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2291 PE=4 SV=1
A0A1D8PD97_CANAL39.08%876e-10Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5201.1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9943
Predicted cleavage: 14

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF64602 (F1 ATPase...)
  2. mobidb-lite (disord...)

Protein sequence

>MCA_01821_1
MLSRAITRRSVQSSISAVRFYTEGATGAPRPMGSNDSFNKREKAQEDLYVRAVEKEKLAKLRESLKKQREHLDEVEKHLD
ALERKE

GO term prediction

Biological Process

GO:0032780 negative regulation of ATPase activity

Molecular Function

GO:0042030 ATPase inhibitor activity

Cellular Component

GO:0005739 mitochondrion