Protein
MCA_01803_1
Length
291 amino acids
Gene name: BUD32
Description: EKC/KEOPS complex subunit Bud32, protein kinase
Browser: contigA:5491203-5492079-
RNA-seq: read pairs 1594, FPKM 67.5, percentile rank 71.8% (100% = highest expression)
Protein function
| Annotation: | BUD32 | EKC/KEOPS complex subunit Bud32, protein kinase | |
|---|---|---|---|
| KEGG: | K08851 | TP53RK | TP53 regulating kinase and related kinases [EC:2.7.11.1] |
| EGGNOG: | 0PQ9A | BUD32 | Component of the EKC KEOPS complex which promotes both telomere uncapping and telomere elongation (By similarity). The complex is required for efficient recruitment of transcriptional coactivators. Important for bud site selection (By similarity) |
| SGD closest match: | S000003494 | BUD32 | EKC/KEOPS complex subunit BUD32 |
| CGD closest match: | CAL0000190041 | BUD32 | EKC/KEOPS complex subunit BUD32 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02383_1 | 63.34% | 311 | 1e-135 | MIA_02383_1 |
| A0A0J9X6P1_GEOCN | 52.04% | 294 | 3e-97 | Similar to Saccharomyces cerevisiae YGR262C BUD32 Protein kinase, component of the EKC/KEOPS complex required for t6A tRNA modification OS=Geotrichum candidum GN=BN980_GECA03s02375g PE=4 SV=1 |
| A0A161HGP8_9ASCO | 51.71% | 292 | 4e-94 | Serine/threonine protein kinase BUD32 OS=Sugiyamaella lignohabitans GN=BUD32 PE=4 SV=1 |
| UniRef50_A0A161HGP8 | 51.71% | 292 | 1e-90 | Serine/threonine protein kinase BUD32 n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A161HGP8_9ASCO |
| A0A1E3PNH0_9ASCO | 49.16% | 299 | 1e-91 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49431 PE=4 SV=1 |
| A0A060T423_BLAAD | 52.76% | 290 | 9e-90 | ARAD1C38324p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C38324g PE=4 SV=1 |
| BUD32_CANAL | 43.89% | 303 | 1e-79 | EKC/KEOPS complex subunit BUD32 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BUD32 PE=3 SV=1 |
| BUD32_YARLI | 48.04% | 281 | 2e-75 | EKC/KEOPS complex subunit BUD32 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BUD32 PE=3 SV=1 |
| BUD32_YEAST | 44.68% | 282 | 6e-72 | EKC/KEOPS complex subunit BUD32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD32 PE=1 SV=1 |
| A0A1E4TKE8_9ASCO | 42.81% | 278 | 6e-63 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_84102 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2437
Protein family membership
- Lipopolysaccharide kinase (IPR010440)
- Serine/threonine-protein kinase Bud32 (IPR022495)
Domains and repeats
-
Domain
1
50
100
150
200
250
291
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MCA_01803_1 MSNVESQLKSLLPNIPIERVSQGAEALIYRTTVHPYLQDIYNSDSCQTFQKPSSYIIKYRPPKTYRHPELDATLTKHRTL SETRLLQKLSIAGINVPSIIYVDFRQGIIWMEDIIGKSNENAECTDIKEEMRGSLKNWIWDIEKEFNENSITENTDDGNL KQTILRVGKEIGKLHLVDIVHGDLTTSNILLRPRSPENIENKLPIEPVIIDFGLGSYSTLAEDKAVDLYVLERAVESTHP VNSELYKAWLLEGYSELFNSEKKVSGPKKLQEIMKKLQDVRLRGRKRSMLG
GO term prediction
Biological Process
GO:0006468 protein phosphorylation
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005524 ATP binding
GO:0016773 phosphotransferase activity, alcohol group as acceptor
Cellular Component
GO:0016020 membrane