Protein

MCA_01781_1

Length
93 amino acids

Description: protein with ribosomal L9/ ribonuclease H1 domain

Browser: contigA:5442631-5442913+

RNA-seq: read pairs 3, FPKM 0.4, percentile rank 6.3% (100% = highest expression)

Protein function

Annotation:protein with ribosomal L9/ ribonuclease H1 domain

Protein alignments

%idAln lengthE-value
UniRef50_A0A1V6TJJ941.82%559e-07Uncharacterized protein n=1 Tax=Penicillium steckii TaxID=303698 RepID=A0A1V6TJJ9_9EURO
A0A167BXM0_9ASCO43.75%482e-06Putative ribonuclease H1 OS=Sugiyamaella lignohabitans GN=AWJ20_3746 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9142
Predicted cleavage: 15

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 93

Detailed signature matches

  1. Domain IPR009027
    Ribosomal protein L9/RNase H1, N-terminal
    1. SSF55658 (L9 N-doma...)
  2. Domain IPR011320
    Ribonuclease H1, N-terminal
    1. PF01693 (Cauli_VI)
    2. G3DSA:3.40.97...

Protein sequence

>MCA_01781_1
MGRQKYYAVRRGRVKGVYKHLQQAQKQIHGYSRCDMKMFYNRDEAWTYVRQSDDNTEDPEYCDPSLLGLNGGYEPGYSCN
FDHDCWDSCNYCA

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.