Protein

MCA_01777_1

Length
305 amino acids

Description: protein with ribosomal L9/ ribonuclease H1 domain

Browser: contigA:5437709-5438646+

RNA-seq: read pairs 1799, FPKM 72.6, percentile rank 73.4% (100% = highest expression)

Protein function

Annotation:protein with ribosomal L9/ ribonuclease H1 domain
KEGG:K03469rnhA ribonuclease HI [EC:3.1.26.4]
EGGNOG:0PJMDPGUG_00082ribonuclease H
CGD closest match:CAL0000184579orf19.5564Uncharacterized protein

Protein alignments

%idAln lengthE-value
UniRef50_B2AD6528.65%3422e-23Ribonuclease H n=2 Tax=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) TaxID=515849 RepID=B2AD65_PODAN
MIA_00166_137.24%1453e-25MIA_00166_1
A0A161HJH2_9ASCO38.93%1492e-22Ribonuclease H OS=Sugiyamaella lignohabitans GN=RNH1 PE=3 SV=1
A0A0J9X3A6_GEOCN36.55%1456e-21Ribonuclease H OS=Geotrichum candidum GN=BN980_GECA01s10097g PE=3 SV=1
A0A1D8PQ03_CANAL33.18%2177e-18Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5564 PE=4 SV=1
A0A060TD98_BLAAD38.26%1492e-16Ribonuclease H OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D41536g PE=3 SV=1
A0A1E3PU38_9ASCO34.81%1581e-14Ribonuclease H OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49110 PE=3 SV=1
Q6CH42_YARLI27.78%2348e-15YALI0A12705p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A12705g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6211

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 305

Detailed signature matches

  1. Family IPR017067
    Ribonuclease H1, eukaryote
    1. PIRSF036852 (RNase_...)
  2. Domain IPR009027
    Ribosomal protein L9/RNase H1, N-terminal
    1. SSF55658 (L9 N-doma...)
  3. Domain IPR011320
    Ribonuclease H1, N-terminal
    1. PF01693 (Cauli_VI)
    2. G3DSA:3.40.97...
  4. Domain IPR012337
    Ribonuclease H-like domain
    1. SSF53098 (Ribonucle...)
    2. G3DSA:3.30.42...
  5. Domain IPR002156
    Ribonuclease H domain
    1. PF00075 (RNase_H)
    2. PS50879 (RNASE_H)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd09280 (RNase_HI_e...)
  2. mobidb-lite (disord...)

Residue annotation

  1. RNA/DNA hybrid bin...

Protein sequence

>MCA_01777_1
MPFNNQKYYAVRRGFCPGVYYNFMDAREQTDGYSYNDMRVFYDYGEALQYLEYESDSEYDDDYDDDYDDDYDDGYGYDDD
YDDDESDDCSNNQKYYAVRRGFRPGVYYNFMDAREQTDGYSYNDMRVFYDYDEAVEYLEYQSEPEEEEEIVETVYVEGSC
IGNGVYSDASMGIGLWYGDGDPRTSDYRLNFAPRCTNNVAELTAIEYAIQNALGTGIDRLVIYTDSSLTKFLPKWISNGF
RTARGTPVANRDIITKIDSLMQKLRAEGVQIDLEYVPAHSGVYGNERANELAIRAARNSMLDMYS

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

Cellular Component

None predicted.