Protein

MCA_01776_1

Length
77 amino acids

Description: protein with ribosomal L9/ ribonuclease H1 domain

Browser: contigA:5435788-5436022+

RNA-seq: read pairs 186, FPKM 29.5, percentile rank 52.3% (100% = highest expression)

Protein function

Annotation:protein with ribosomal L9/ ribonuclease H1 domain

Protein alignments

%idAln lengthE-value
UniRef50_UPI0007AF32DA38.98%594e-06UPI0007AF32DA related cluster n=1 Tax=unknown TaxID= RepID=UPI0007AF32DA
Q6C6C0_YARLI44.23%522e-06YALI0E10725p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E10725g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6202

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 77

Detailed signature matches

  1. Domain IPR009027
    Ribosomal protein L9/RNase H1, N-terminal
    1. SSF55658 (L9 N-doma...)
  2. Domain IPR011320
    Ribonuclease H1, N-terminal
    1. PF01693 (Cauli_VI)
    2. G3DSA:3.40.97...

Protein sequence

>MCA_01776_1
MPPKKSKYYAVRRGFCPGVYYNSVDARKQTDGYSHNDMRVFYDYNEAVEYLECESDESSFSYLCDDDYEYVYYDDDY

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.