Protein

MCA_01757_1

Length
388 amino acids


Gene name: RPL3

Description: 60S ribosomal protein L3

Browser: contigA:5386385-5387740+

RNA-seq: read pairs 77186, FPKM 2451.7, percentile rank 98.0% (100% = highest expression)

Protein function

Annotation:RPL360S ribosomal protein L3
KEGG:K02925RP-L3e large subunit ribosomal protein L3e
EGGNOG:0PGH7RPL360S ribosomal protein L3
SGD closest match:S000005589RPL360S ribosomal protein L3
CGD closest match:CAL0000201023RPL3Ribosomal 60S subunit protein L3

Protein alignments

%idAln lengthE-value
MIA_04669_188.40%3880.0MIA_04669_1
A0A161HJY0_9ASCO86.27%3860.0Ribosomal 60S subunit protein L3 OS=Sugiyamaella lignohabitans GN=RPL3 PE=3 SV=1
RL3_YEAST85.01%3870.060S ribosomal protein L3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL3 PE=1 SV=4
UniRef50_P1412685.01%3870.060S ribosomal protein L3 n=79 Tax=cellular organisms TaxID=131567 RepID=RL3_YEAST
Q59LS1_CANAL83.76%3880.0Ribosomal 60S subunit protein L3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL3 PE=3 SV=1
A0A060TDX1_BLAAD83.72%3870.0ARAD1D10868p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D10868g PE=3 SV=1
A0A1E3PU47_9ASCO82.47%3880.060S ribosomal protein L3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81359 PE=3 SV=1
Q6CB65_YARLI80.10%3870.0YALI0C21560p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C21560g PE=3 SV=1
A0A1E4THG7_9ASCO78.04%3870.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_120880 PE=3 SV=1
A0A0F7RR25_GEOCN85.80%1767e-91Similar to Saccharomyces cerevisiae YOR063W RPL3 Protein component of the large (60S) ribosomal subunit,partial (Partial) (Fragment) OS=Geotrichum candidum GN=BN980_GECA01s02017g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1897
Predicted cleavage: 28

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 388

Detailed signature matches

    1. PF00297 (Ribosomal_L3)
    1. SSF50447 (Translati...)
    1. PS00474 (RIBOSOMAL_L3)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_01757_1
MSHRKYEAPRHGSLAFLPRKRAASQRGKVKAFPKDDKTKPIALTAFLGYKAGMTTIVRDLDRRGSKYDKREIVEAVTIVD
TPPVVVVGVVGYVETARGLRSITTVWAEHLSDEVKRRFYKNWYQSKRKAFTKYTKKYADGAADIERELARIKKYATVVRV
LVHTQIRKTPLAQKKAHLAEIQINGGSIEDKVEWAKEHFEKTVEVSSVFEQDEMIDVIAVTKGHGTEGVTHRWGTKKLPR
KTHRGLRKVACIGAWHPAHVNWTVARAGQNGYHHRTSFNHKVYRIGKGDDESNGSTEFDRTKKTITPMGGFVRYGEIKND
FVMIKGSIPGAKKRIITLRKSLQTHTSRKALEKVQLKWIDTASKFGKGRFQTAAEKHTFMGTLKKDLE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome