Protein

MCA_01733_1

Length
86 amino acids


Gene name: APC11

Description: Anaphase-promoting complex subunit 11

Browser: contigA:5321170-5321522+

RNA-seq: read pairs 58, FPKM 8.2, percentile rank 22.8% (100% = highest expression)

Protein function

Annotation:APC11Anaphase-promoting complex subunit 11
KEGG:K03358APC11 anaphase-promoting complex subunit 11
EGGNOG:0PQNCAPC11complex subunit
SGD closest match:S000002166APC11Anaphase-promoting complex subunit 11
CGD closest match:CAL0000187239CAALFM_CR10610CAAnaphase promoting complex subunit 11

Protein alignments

%idAln lengthE-value
MIA_00682_179.76%843e-49MIA_00682_1
A0A0J9X5Q3_GEOCN75.00%844e-46Similar to Saccharomyces cerevisiae YDL008W APC11 Catalytic core subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C) OS=Geotrichum candidum GN=BN980_GECA03s02452g PE=4 SV=1
Q6C1E3_YARLI76.54%813e-44YALI0F17050p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F17050g PE=4 SV=1
UniRef50_Q6C1E376.54%816e-41YALI0F17050p n=41 Tax=Opisthokonta TaxID=33154 RepID=Q6C1E3_YARLI
A0A1E3PSQ1_9ASCO72.29%832e-44RING finger domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_54823 PE=4 SV=1
A0A060TB97_BLAAD69.05%842e-41ARAD1B06468p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B06468g PE=4 SV=1
A0A1E4TAL9_9ASCO65.85%824e-39Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29261 PE=4 SV=1
A0A1D8PU99_CANAL57.95%885e-34Anaphase promoting complex subunit 11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR10610CA PE=4 SV=1
APC11_YEAST50.00%983e-31Anaphase-promoting complex subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APC11 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0687

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 86

Detailed signature matches

    1. PF12861 (zf-ANAPC11)
    1. SM00184 (ring_2)
    2. PS50089 (ZF_RING_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF57850 (RING/U-box)
  2. cd16456 (RING-H2_APC11)

Residue annotation

  1. Zn binding site cd...
  2. polypeptide substr...

Protein sequence

>MCA_01733_1
MKVTIKQWNAVATWKWDVKGEEVCGICREKFEGTCPKCKYPGDNCPLIIGPCNHSFHLHCMLKWLDTDTSQGLCPMCRQP
FTTTLT

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0004842 ubiquitin-protein transferase activity

Cellular Component

GO:0005680 anaphase-promoting complex