Protein

MCA_01708_1

Length
517 amino acids

Gene name: MRP4

Description: 37S ribosomal protein MRP4, mitochondrial

Browser: contigA:5241820-5243445+

RNA-seq: read pairs 5951, FPKM 142.0, percentile rank 84.3% (100% = highest expression)

Protein function

Annotation:MRP437S ribosomal protein MRP4, mitochondrial
KEGG:K02967RP-S2 small subunit ribosomal protein S2
EGGNOG:0PFVKMRP4mitochondrial 37S ribosomal protein MRP4
SGD closest match:S000000996MRP437S ribosomal protein MRP4, mitochondrial
CGD closest match:CAL0000181894orf19.5747Mitochondrial 37S ribosomal protein MRP4

Protein alignments

%idAln lengthE-value
MIA_04869_160.81%3933e-162MIA_04869_1
A0A0J9X8U9_GEOCN69.68%3102e-157Similar to Saccharomyces cerevisiae YHL004W MRP4 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA06s01033g PE=3 SV=1
UniRef50_A0A0J9X8U969.68%3103e-154Similar to Saccharomyces cerevisiae YHL004W MRP4 Mitochondrial ribosomal protein of the small subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X8U9_GEOCN
A0A167DPU6_9ASCO51.20%3342e-121Mitochondrial 37S ribosomal protein MRP4 OS=Sugiyamaella lignohabitans GN=MRP4 PE=3 SV=1
A0A060T8A2_BLAAD51.85%3249e-120ARAD1C35156p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C35156g PE=3 SV=1
A0A1E3PGG5_9ASCO58.08%2605e-114Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47178 PE=3 SV=1
RT04_YEAST54.44%2594e-9937S ribosomal protein MRP4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP4 PE=1 SV=1
A0A1D8PQ89_CANAL49.44%2675e-88Mitochondrial 37S ribosomal protein MRP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5747 PE=3 SV=1
Q6C1V9_YARLI44.78%2681e-80YALI0F12991p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F12991g PE=3 SV=1
A0A1E4TMD1_9ASCO40.96%2495e-59Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_15548 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9937
Predicted cleavage: 40

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 450 517

Detailed signature matches

  1. Family IPR001865
    Ribosomal protein S2
    1. PR00395 (RIBOSOMALS2)
    2. PF00318 (Ribosomal_S2)
    3. cd01425 (RPS2)
  2. Family IPR005706
    Ribosomal protein S2, bacteria/mitochondria/plastid
    1. TIGR01011
    2. MF_00291_B (Ribosom...)
  3. Domain IPR023591
    Ribosomal protein S2, flavodoxin-like domain
    1. SSF52313 (Ribosomal...)
  4. SITE IPR018130
    Ribosomal protein S2, conserved site
    1. PS00963 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.40.50...
  3. mobidb-lite (disord...)

Residue annotation

  1. rRNA interaction s...
  2. S8 interaction sit...
  3. putative laminin-1...

Protein sequence

>MCA_01708_1
MSFVRLIQARRLANIAPRGFNAQPIYKSQRSFTTRVGLFQENGKPSSPEEPIQKQQTTTEEPVKETPAFSDAELSSTETF
TQFESNSTTKASKAPNSDSPVQESKNQEQSNSQYTPEQIVEHTVFEQSFSNLVQSSKDISPELAAKLDKEFGALLKDFVA
DANLATAFPELNPVKAIKKASGSASSFSSSKAQYPNVRITHSSEPYSEQEIWLRKQHQAKVLGNLGSEITDVYRPHEDVL
KPKGIASTTWETLLAAGVHLGHSVSMFRPSTQPYIYGVRDGIHIINLETTLAHLRRAAKVAEEISENGGIILYVGTRPGQ
QRSLELAAKRSKGYYVHKRWVPGTLTNCREVSQHWERTELDMGDNETGRLLSPNVKRSLIKPDLVVILNPVENRNAIYEC
IQSNVPTIGIVDTNSEPSLLSYPIPGNDDSIRATDLIVGVISKSAERGRQTRLKLFQEFKKQKQYAPLDDPSEEGIEGEA
ATLAKPSRGKSRYNNRTIDTASTDFYEKAISELSKNM

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome
GO:0015935 small ribosomal subunit