Protein

MCA_01643_1

Length
782 amino acids

Browser: contigA:5058075-5060601-

RNA-seq: read pairs 2031, FPKM 32.0, percentile rank 54.6% (100% = highest expression)

Protein function

KEGG:K11836USP5_13 ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
EGGNOG:0PFVYPGUG_02717ubiquitin carboxyl-terminal hydrolase
SGD closest match:S000000262UBP14Ubiquitin carboxyl-terminal hydrolase 14
CGD closest match:CAL0000182125orf19.1516Ubiquitinyl hydrolase 1

Protein alignments

%idAln lengthE-value
MIA_02491_162.56%7800.0MIA_02491_1
A0A0J9XK21_GEOCN52.95%7970.0Ubiquitinyl hydrolase 1 OS=Geotrichum candidum GN=BN980_GECA21s00373g PE=3 SV=1
A0A060SX76_BLAAD51.52%7880.0Ubiquitinyl hydrolase 1 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A11220g PE=3 SV=1
A0A1E3PSV8_9ASCO47.76%8020.0Ubiquitinyl hydrolase 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49061 PE=3 SV=1
UniRef50_A0A1E1L7U945.12%7890.0Ubiquitinyl hydrolase 1 n=7 Tax=Fungi TaxID=4751 RepID=A0A1E1L7U9_9HELO
A0A161HF54_9ASCO48.79%7050.0Ubiquitinyl hydrolase 1 OS=Sugiyamaella lignohabitans GN=UBP14 PE=3 SV=1
Q6CEB0_YARLI42.42%7780.0Ubiquitinyl hydrolase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B17072g PE=3 SV=1
A0A1E4TGP0_9ASCO40.98%7930.0Ubiquitinyl hydrolase 1 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_23877 PE=3 SV=1
A0A1D8PGI9_CANAL39.45%8011e-165Ubiquitinyl hydrolase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1516 PE=3 SV=1
UBP14_YEAST34.86%8093e-125Ubiquitin carboxyl-terminal hydrolase 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP14 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0184

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 100 200 300 400 500 600 700 782

Detailed signature matches

  1. Family IPR016652
    Ubiquitinyl hydrolase
    1. PIRSF016308 (UBP)
  2. Domain IPR013083
    Zinc finger, RING/FYVE/PHD-type
    1. G3DSA:3.30.40.10
  3. Domain IPR001607
    Zinc finger, UBP-type
    1. SM00290 (Zf_UBP_1)
    2. PS50271 (ZF_UBP)
    3. PF02148 (zf-UBP)
  4. Domain IPR028889
    Ubiquitin specific protease domain
    1. PS50235 (USP_3)
  5. Domain IPR001394
    Peptidase C19, ubiquitin carboxyl-terminal hydrolase
    1. PF00443 (UCH)
  6. Domain IPR009060
    UBA-like
    1. SSF46934 (UBA-like)
  7. Domain IPR015940
    Ubiquitin-associated domain
    1. SM00165 (uba_6)
    2. PF00627 (UBA)
    3. PS50030 (UBA)
  8. SITE IPR018200
    Ubiquitin specific protease, conserved site
    1. PS00972 (USP_1)
    2. PS00973 (USP_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.90.70.10
  2. SSF54001 (Cysteine ...)
  3. SSF57850 (RING/U-box)
  4. cd02658 (Peptidase_...)
  5. cd14296 (UBA1_scUBP...)
  6. mobidb-lite (disord...)

Residue annotation

  1. Active Site cd02658

Protein sequence

>MCA_01643_1
MASVLDHILSLGLQPPTSNTNVYKDECAYTFDSPFTQYGVDVCLTCFKGSTPDPARNYTDAHYKKFGHSVFLNIRKVSKR
ERGELPTKIAKLEIKEEKEEDLYNTITKVKDLEFPDQEVDSSIPELKKVVDGVLNSISASQKQDILEWRPEVSVCPHTLD
LNQENNNVKVKTGNPCSQCDLKENLWLCLICGALNCGRNQLGGAPGNSHGIAHYDSTHHPVAVKLGSITPDGTADIYCYA
CDDEVKDHHLAEHLAHFGINIADAEKTEKSLTEMQLEQNVKWDFSMVSETGQDLEPLFGPGFTGLKNLGNSCYISSVLQC
LFSLPQFIKGYYRPDEMQKIIDNPESNLEVQLVKLADGLLSGRYAVPDPDLNNEGKPTQRGIPPAAFKKLIGEGHAEFSS
MKQQDSFEFLTYFLGKLQAYCKSNKLNDPSKIFKFKTEQRLECLGCHKVRYNTTVQEALTLQVPVRRISNAETEDEDDTF
ETVNITELFDNFTKTEEVDYKCKSCSNPNSIKKVSFETFPDSLILNAQRFEIINWVPTKLNIPLEVSGDELTLSEYKAKE
HSPDEDIAMDDDDDEEDKSEKFVANPEALEFLVQMGYTRNCAERALFNTENQLEASVEWIMSHMDDPDLNDPFSVGGKKA
KPAVSKDQVEQLTMMGFSENAARKALYEAKGNNEAAVEWLFSNSDDPGYSEAELDELVNGSEGSNDDDDVYCGSGELPAN
YKLKAIVCHKGRSVHAGHYVAFIKKEVKGVEQWVLYNDEKVVSGGEIEEMKKYAYIYIFTRV

GO term prediction

Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process
GO:0016579 protein deubiquitination

Molecular Function

GO:0004843 thiol-dependent ubiquitin-specific protease activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0036459 thiol-dependent ubiquitinyl hydrolase activity

Cellular Component

None predicted.