Protein
MCA_01612_1
Length
64 amino acids
Browser: contigA:4969784-4970044-
RNA-seq: read pairs 914, FPKM 173.7, percentile rank 86.5% (100% = highest expression)
Protein function
| CGD closest match: | CAL0000183241 | orf19.242.2 | Uncharacterized protein |
|---|
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05937_1 | 53.12% | 64 | 3e-19 | MIA_05937_1 |
| A0A060TB51_BLAAD | 51.56% | 64 | 5e-17 | ARAD1D32054p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D32054g PE=4 SV=1 |
| A0A0J9XEF1_GEOCN | 50.75% | 67 | 2e-15 | Similar to Saccharomyces cerevisiae YBR162W-A YSY6 Protein that participates in secretory pathway OS=Geotrichum candidum GN=BN980_GECA12s01429g PE=4 SV=1 |
| UniRef50_A0A165K2I7 | 46.03% | 63 | 3e-10 | Uncharacterized protein n=6 Tax=saccharomyceta TaxID=716545 RepID=A0A165K2I7_9PEZI |
| A0A1E3PL40_9ASCO | 49.12% | 57 | 3e-13 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51402 PE=4 SV=1 |
| A0A1D8PJJ9_CANAL | 45.28% | 53 | 4e-10 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.242.2 PE=4 SV=1 |
| A0A1E4TE12_9ASCO | 35.19% | 54 | 2e-06 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_56616 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3568
Protein family membership
- Stress-associated endoplasmic reticulum protein (IPR010580)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_01612_1 MGTSAAIRRGNEKFAKREDLKRGKPHKKQTTSEPLPLSKGWIAFLIFLVMGGAIFEVLKLFGAL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0005783 endoplasmic reticulum