Protein
MCA_01582_1
Length
125 amino acids
Browser: contigA:4890725-4891103-
RNA-seq: read pairs 650, FPKM 63.7, percentile rank 70.6% (100% = highest expression)
Protein function
KEGG: | K12834 | PHF5A | PHD finger-like domain-containing protein 5A |
---|---|---|---|
EGGNOG: | 0PP1G | FG06746.1 | factor ini1 |
SGD closest match: | S000006298 | RDS3 | Pre-mRNA-splicing factor RDS3 |
CGD closest match: | CAL0000192121 | orf19.2230 | U2 snRNP complex subunit |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_02478_1 | 71.77% | 124 | 1e-61 | MIA_02478_1 |
A0A1E3PE29_9ASCO | 63.41% | 123 | 3e-57 | Pre-mRNA-splicing factor ini1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47983 PE=4 SV=1 |
A0A060T2R9_BLAAD | 62.90% | 124 | 3e-54 | ARAD1A10692p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A10692g PE=4 SV=1 |
UniRef50_A0A1U7LLP9 | 64.17% | 120 | 4e-48 | PHD finger-like domain-containing protein 5B n=3 Tax=Fungi TaxID=4751 RepID=A0A1U7LLP9_9ASCO |
Q6CCN2_YARLI | 59.84% | 122 | 1e-49 | YALI0C08030p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C08030g PE=4 SV=1 |
A0A0J9X524_GEOCN | 60.94% | 128 | 2e-48 | Similar to Saccharomyces cerevisiae YPR094W RDS3 Component of the SF3b subcomplex of the U2 snRNP OS=Geotrichum candidum GN=BN980_GECA02s01990g PE=4 SV=1 |
A0A1E4TK35_9ASCO | 53.85% | 117 | 1e-41 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_21518 PE=4 SV=1 |
RDS3_YEAST | 50.42% | 119 | 1e-36 | Pre-mRNA-splicing factor RDS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDS3 PE=1 SV=1 |
Q59Z68_CANAL | 46.77% | 124 | 1e-33 | U2 snRNP complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2230 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0302
Predicted cleavage: 19
Protein family membership
- PHF5-like (IPR005345)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF03660 (PHF5)
-
PIRSF016468 (RDS3p)
-
Protein sequence
>MCA_01582_1 MSRHRPDLIMCMKQPGRHVGRLCEKCEDRCPICDSFVRPTTLVKICEECAFQTASDQPNQQQQDGTATSGKCIMCGGPGV SDAYYCYECTMLERDRDGCPKIINVGSSRSDLWYEKKKTKQQQQL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.