Protein
MCA_01529_1
Length
100 amino acids
Gene name: COA3
Description: Cytochrome c oxidase assembly factor 3, mitochondrial
Browser: contigA:4735955-4736330-
RNA-seq: read pairs 2039, FPKM 249.4, percentile rank 90.4% (100% = highest expression)
Protein function
Annotation: | COA3 | Cytochrome c oxidase assembly factor 3, mitochondrial | |
---|---|---|---|
KEGG: | K18176 | COA3 | cytochrome c oxidase assembly factor 3, fungi type |
EGGNOG: | 0PRHV | COA3 | Required for assembly of cytochrome c oxidase (complex IV) (By similarity) |
SGD closest match: | S000007611 | COA3 | Cytochrome c oxidase assembly factor 3, mitochondrial |
CGD closest match: | CAL0000198228 | orf19.6563.1 | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_05207_1 | 61.29% | 93 | 1e-39 | MIA_05207_1 |
A0A0J9XIE8_GEOCN | 53.01% | 83 | 2e-30 | Similar to Saccharomyces cerevisiae YJL062W-A COA3 Mitochondrial inner membrane protein that participates in regulation of COX1 translation OS=Geotrichum candidum GN=BN980_GECA18s02210g PE=4 SV=1 |
UniRef50_A0A0J9XIE8 | 53.01% | 83 | 3e-27 | Similar to Saccharomyces cerevisiae YJL062W-A COA3 Mitochondrial inner membrane protein that participates in regulation of COX1 translation n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XIE8_GEOCN |
COA3_YARLI | 45.56% | 90 | 1e-24 | Cytochrome c oxidase assembly factor 3, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COA3 PE=3 SV=1 |
A0A1E3PPT6_9ASCO | 50.00% | 66 | 4e-18 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45547 PE=4 SV=1 |
A0A1D8PQV7_CANAL | 38.96% | 77 | 2e-16 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6563.1 PE=4 SV=1 |
A0A060T0A6_BLAAD | 46.88% | 96 | 6e-14 | ARAD1C11418p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C11418g PE=4 SV=1 |
COA3_YEAST | 43.24% | 74 | 9e-13 | Cytochrome c oxidase assembly factor 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COA3 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0430
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_01529_1 MPSSRPEEYKPVFQTSKYQNPINYTMSPAALRARRPFIVKNALTALGFFSFAAGVYFYSLNALVQDDFADVPIPPISDEK LAELKKNYEEDKKAIMESKK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.