Protein

MCA_01495_1

Length
421 amino acids


Gene name: RPN6

Description: 26S proteasome regulatory subunit RPN6

Browser: contigA:4629537-4630887-

RNA-seq: read pairs 4481, FPKM 131.2, percentile rank 83.0% (100% = highest expression)

Protein function

Annotation:RPN626S proteasome regulatory subunit RPN6
KEGG:K03036PSMD11 26S proteasome regulatory subunit N6
EGGNOG:0PJ50RPN626S proteasome non-ATPase regulatory subunit 11
SGD closest match:S000002255RPN626S proteasome regulatory subunit RPN6
CGD closest match:CAL0000176073RPN6Proteasome regulatory particle lid subunit

Protein alignments

%idAln lengthE-value
MIA_06272_185.04%4210.0MIA_06272_1
A0A0J9XFX5_GEOCN76.25%4210.0Similar to Saccharomyces cerevisiae YDL097C RPN6 Essential, non-ATPase regulatory subunit of the 26S proteasome lid OS=Geotrichum candidum GN=BN980_GECA14s01858g PE=4 SV=1
A0A1E3PI61_9ASCO68.93%4120.0PCI-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83150 PE=4 SV=1
A0A060SWK1_BLAAD69.67%4220.0ARAD1A02024p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A02024g PE=4 SV=1
Q6C9R4_YARLI68.18%4180.0YALI0D08976p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D08976g PE=4 SV=1
UniRef50_C5M2N260.67%4170.026S proteasome regulatory subunit RPN6 n=31 Tax=Saccharomycetales TaxID=4892 RepID=C5M2N2_CANTT
A0A1D8PLW8_CANAL59.53%4300.0Proteasome regulatory particle lid subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPN6 PE=4 SV=1
A0A167D8S6_9ASCO63.21%4050.0Proteasome regulatory particle lid subunit RPN6 OS=Sugiyamaella lignohabitans GN=RPN6 PE=4 SV=1
RPN6_YEAST51.52%4272e-14526S proteasome regulatory subunit RPN6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN6 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1422

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 50 100 150 200 250 300 350 421

Detailed signature matches

    1. SSF48452 (TPR-like)
    1. SM00088 (PINT_4)
    2. PF01399 (PCI)
    1. SSF46785 ("Winged h...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SM00753 (PINT)

Protein sequence

>MCA_01495_1
MSEALNKKLESARAYAKNQQLAEAETTYRTILQTPAENNAKIVAIQENALYELGKLYQEHKKVEQLADLIKTSRTVLGSF
AKSKTAKIIRNLIDLFTPLTGSIDIQISTIKDCVEWAVSERRNFLRQNLETRLISLYYEKSSYNEAIKLINSLLKELKRL
DDKMVLIEVQLLEAKVYQALRNIPKAKASLTSARTSANTVYTPPLMQASLDMMSGILQSEDKDYKTGYSYFYEAFEGFSS
QEDPRALTVLKYLLLSKIMLNLSDDVESLLTNKTVQKYSGRDIDAMKAIATAYSHRSLKEFEAALDTYRKELSSDPFIRS
HFTDLYDTLLEQNLVKVIEPFSCVELSHVAEIIGLDTKQVEGKLSQMILDKVFHGVLDQGNGWLFVYEEPKVDATYDAAL
ETVKHMSNVVDLLYEKASALN

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005515 protein binding

Cellular Component

None predicted.