Protein

MCA_01482_1

Length
369 amino acids


Gene name: GLN1

Description: Glutamine synthetase

Browser: contigA:4592172-4593282-

RNA-seq: read pairs 45748, FPKM 1527.7, percentile rank 97.4% (100% = highest expression)

Protein function

Annotation:GLN1Glutamine synthetase
KEGG:K01915glnA glutamine synthetase [EC:6.3.1.2]
EGGNOG:0PI17GLN1glutamine synthetase
SGD closest match:S000006239GLN1Glutamine synthetase
CGD closest match:CAL0000185613GLN1Glutamine synthetase

Protein alignments

%idAln lengthE-value
MIA_00318_191.58%3680.0MIA_00318_1
A0A0J9XGS9_GEOCN88.37%3610.0Glutamine synthetase OS=Geotrichum candidum GN=BN980_GECA13s03288g PE=3 SV=1
A0A161HI63_9ASCO84.11%3650.0Glutamine synthetase OS=Sugiyamaella lignohabitans GN=GLN1 PE=3 SV=1
A0A060T265_BLAAD81.37%3650.0Glutamine synthetase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C26554g PE=3 SV=1
A0A1E3PGJ6_9ASCO81.10%3650.0Glutamine synthetase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52193 PE=3 SV=1
A0A1E4TM43_9ASCO79.10%3540.0Glutamine synthetase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1425 PE=3 SV=1
GLNA_YARLI79.78%3560.0Glutamine synthetase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLN1 PE=3 SV=1
GLNA_YEAST76.09%3680.0Glutamine synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN1 PE=1 SV=4
UniRef50_P3228876.09%3680.0Glutamine synthetase n=738 Tax=Eukaryota TaxID=2759 RepID=GLNA_YEAST
A0A1D8PSY1_CANAL75.07%3650.0Glutamine synthetase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GLN1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1798

Protein family membership

None predicted.

Domains and repeats

1 50 100 150 200 250 300 369

Detailed signature matches

    1. SSF54368 (Glutamine...)
    2. PF03951 (Gln-synt_N)
    1. PF00120 (Gln-synt_C)
    2. SM01230 (Gln_synt_C_2)
    1. PS00180 (GLNA_1)
    1. PS00181 (GLNA_ATP)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF55931 (Glutamine...)

Protein sequence

>MCA_01482_1
MAQTSIISNGANLAKYMELPQKGAILAEYIWIDGTNSIRSKCRTLYKKPESAEDLPEWNFDGSSTEQAPGDNSDIYLRPV
AIYPDPMRRGDNIIVLAECYNADGTPNQFNYRHECAKLMEAHKDAEIWFGIEQEYTLFDNLGNVYGWPLGGYPAPQGPYY
CGVGTGKVYCRDIVEAHYRACLYAGIRISGINAEVMPSQWEFQVGPCDGISMGDELTVARYLLHRVAEDFGVVISFHPKP
LKGDWNGAGCHTNVSTKEMREEGGMKYIEEAIEKLSKRHKEHIAVYGEDNDLRLTGRHETASVANFSYGVANRGSSIRIP
RSVAKEGKGYFEDRRPASNIDPYLVTGIMTETILGSIPDVDVVKQVTKN

GO term prediction

Biological Process

GO:0006542 glutamine biosynthetic process
GO:0006807 nitrogen compound metabolic process

Molecular Function

GO:0003824 catalytic activity
GO:0004356 glutamate-ammonia ligase activity

Cellular Component

None predicted.