Protein

MCA_01469_1

Length
136 amino acids


Gene name: RPL14B

Description: 60S ribosomal protein L14-B

Browser: contigA:4553298-4554058-

RNA-seq: read pairs 27053, FPKM 2439.9, percentile rank 98.0% (100% = highest expression)

Protein function

Annotation:RPL14B60S ribosomal protein L14-B
KEGG:K02875RP-L14e large subunit ribosomal protein L14e
EGGNOG:0PQ23FG08561.160S ribosomal protein L14
SGD closest match:S000000993RPL14B60S ribosomal protein L14-B
CGD closest match:CAL0000179395RPL14Ribosomal 60S subunit protein L14B

Protein alignments

%idAln lengthE-value
MIA_00217_171.30%1152e-49MIA_00217_1
A0A0J9XF92_GEOCN56.14%1143e-43Similar to Saccharomyces cerevisiae YKL006W RPL14A N-terminally acetylated protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA11s03134g PE=4 SV=1
A0A1E3PFU1_9ASCO56.64%1132e-41Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47451 PE=4 SV=1
A0A060TAS0_BLAAD56.14%1145e-40ARAD1B02948p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B02948g PE=4 SV=1
UniRef50_A0A0L1JEB952.94%1192e-3660S ribosomal protein L14 n=10 Tax=Aspergillaceae TaxID=1131492 RepID=A0A0L1JEB9_ASPNO
A0A1D8PFL9_CANAL53.91%1155e-38Ribosomal 60S subunit protein L14B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL14 PE=4 SV=1
RL14B_YEAST55.75%1133e-3560S ribosomal protein L14-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL14B PE=1 SV=1
A0A1E4TAJ9_9ASCO48.67%1131e-32Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3325 PE=4 SV=1
Q6C7I6_YARLI45.69%1163e-25YALI0E00550p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E00550g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0344

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 20 40 60 80 100 120 136

Detailed signature matches

    1. SSF50104 (Translati...)
    1. SM00739 (kow_9)
    2. PF00467 (KOW)
    1. PF01929 (Ribosomal_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd06088 (KOW_RPL14)

Residue annotation

  1. RNA binding site c...

Protein sequence

>MCA_01469_1
MSINIEETKWKYVELGRVVLIKDGKYANKLATIVEIIDHKRALVDGPEIPRQAVVLTHVKLTDYVIEDVPLAASTEEVSK
LWKAADIDGKWAESKLAKKIAQQERRSQLTDFERFQVALLKKQKKLAVHKAVAASN

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome