Protein
MCA_01427_1
Length
260 amino acids
Gene name: ISY1
Description: Pre-mRNA-splicing factor ISY1
Browser: contigA:4432441-4433224+
RNA-seq: read pairs 473, FPKM 22.4, percentile rank 44.4% (100% = highest expression)
Protein function
| Annotation: | ISY1 | Pre-mRNA-splicing factor ISY1 | |
|---|---|---|---|
| KEGG: | K12870 | ISY1 | pre-mRNA-splicing factor ISY1 |
| EGGNOG: | 0PKY9 | ISY1 | pre-mRNA-splicing factor isy1 |
| SGD closest match: | S000003811 | ISY1 | Pre-mRNA-splicing factor ISY1 |
| CGD closest match: | CAL0000193301 | ISY1 | Pre-mRNA-splicing factor ISY1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02524_1 | 62.79% | 258 | 4e-112 | MIA_02524_1 |
| A0A0J9X4W0_GEOCN | 52.87% | 261 | 1e-81 | Similar to Saccharomyces cerevisiae YJR050W ISY1 Member of NineTeen Complex (NTC) that contains Prp19p and stabilizes U6 snRNA in catalytic forms of spliceosome containing U2 OS=Geotrichum candidum GN=BN980_GECA02s06742g PE=4 SV=1 |
| UniRef50_A0A0J9X4W0 | 52.87% | 261 | 2e-78 | Similar to Saccharomyces cerevisiae YJR050W ISY1 Member of NineTeen Complex (NTC) that contains Prp19p and stabilizes U6 snRNA in catalytic forms of spliceosome containing U2 n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X4W0_GEOCN |
| A0A1E3PSK2_9ASCO | 45.25% | 263 | 8e-58 | Isy1-like splicing factor OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81035 PE=4 SV=1 |
| A0A060TA41_BLAAD | 43.89% | 262 | 1e-55 | ARAD1D24200p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D24200g PE=4 SV=1 |
| A0A167CBE5_9ASCO | 46.03% | 252 | 5e-54 | Isy1p OS=Sugiyamaella lignohabitans GN=ISY1 PE=4 SV=1 |
| ISY1_YARLI | 38.04% | 255 | 7e-40 | Pre-mRNA-splicing factor ISY1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ISY1 PE=3 SV=1 |
| ISY1_CANAL | 34.56% | 272 | 4e-29 | Pre-mRNA-splicing factor ISY1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISY1 PE=3 SV=1 |
| A0A1E4TJ20_9ASCO | 32.24% | 214 | 5e-27 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_55493 PE=4 SV=1 |
| ISY1_YEAST | 33.08% | 263 | 3e-23 | Pre-mRNA-splicing factor ISY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISY1 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7463
Protein family membership
- Pre-mRNA-splicing factor Isy1 (IPR009360)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Protein sequence
>MCA_01427_1 MSRNSEKAQSMLYRFREQQAAESGFVDVNRVRRPRNVRSVDNLSMCERWRGQVVKEIGQKIVKIQDESLSEYQIRDLNDE INKLMREKLAWEYQIKSLGGPNYIRHGGKVYDDQGNEIPQIVMGGKSNSGYKYFGRARELPDVKELITQEMKQRKMKQDQ LAQSKIDQARFRSLPAEYYGFEEVKGISKYEMILKKEKLYSKQKFLDVLNSQTPEQQKAVETFESIDDELINNIPTQADV EKYLIERLKKTIEDKYNLDN
GO term prediction
Biological Process
GO:0000350 generation of catalytic spliceosome for second transesterification step
Molecular Function
None predicted.
Cellular Component
None predicted.