Protein

MCA_01423_1

Length
334 amino acids


Gene name: ATP11

Description: Protein ATP11, mitochondrial

Browser: contigA:4424480-4425485-

RNA-seq: read pairs 1938, FPKM 71.5, percentile rank 73.1% (100% = highest expression)

Protein function

Annotation:ATP11Protein ATP11, mitochondrial
KEGG:K07555ATPeAF1 ATP synthase mitochondrial F1 complex assembly factor 1
EGGNOG:0PGSUPGUG_04192assembly protein
SGD closest match:S000005259ATP11Protein ATP11, mitochondrial
CGD closest match:CAL0000201892orf19.6916Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_02520_162.24%3396e-153MIA_02520_1
A0A0J9XAN6_GEOCN62.91%3023e-127Similar to Saccharomyces cerevisiae YNL315C ATP11 Molecular chaperone required for the assembly of alpha and beta subunits into the F1 sector of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA08s00780g PE=4 SV=1
UniRef50_A0A0J9XAN662.91%3025e-124Similar to Saccharomyces cerevisiae YNL315C ATP11 Molecular chaperone required for the assembly of alpha and beta subunits into the F1 sector of mitochondrial F1F0 ATP synthase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XAN6_GEOCN
A0A060THS8_BLAAD45.09%2755e-86ARAD1D40326p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D40326g PE=4 SV=1
Q6CEA1_YARLI43.55%2874e-78YALI0B17314p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B17314g PE=4 SV=1
A0A1E3PRB0_9ASCO38.59%3113e-76ATP11-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81070 PE=4 SV=1
ATP11_YEAST41.07%2807e-75Protein ATP11, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP11 PE=1 SV=1
A0A1D8PQT7_CANAL41.05%2852e-61Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6916 PE=4 SV=1
A0A1E4TCW9_9ASCO34.32%3032e-48Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_141245 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9546
Predicted cleavage: 41

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF06644 (ATP11)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_01423_1
MYRMVANQGKRLTMGATPSSLSSPLVKAAFNALVTQKRTYAEVLPYLDPAMASQVKADQVAERYREKLLQKAKAEGASSI
DELKDKYKDKIETQKKVYEKADPYAKLHEKENVPDNQTETAKAASEAIKNAPKVPSSDIKSLDTFIDVSKFKLHNNKEIE
MLWKMRFSSNPRAICGLVTGDTFATIYKNARKNPMFILPLPHEAPDAEKTGNGGGVEMHLVQWTFVGPYTIHCILTTLAE
YKLHQEYAKPHTTLIFHSDLLADKGIALLNGTVEKEATVNMDEAHLLTLFLQKFYSATPATESGKKKLELLSAFTNGDEN
FSVDELLSQAETIE

GO term prediction

Biological Process

GO:0006461 protein complex assembly

Molecular Function

None predicted.

Cellular Component

GO:0005739 mitochondrion