Protein

MCA_01398_2

Length
200 amino acids


Browser: contigA:4362688-4363291+

RNA-seq: read pairs 106308, FPKM 6535.1, percentile rank 99.8% (100% = highest expression)

Protein function

KEGG:K02995RP-S8e small subunit ribosomal protein S8e
EGGNOG:0PI2HFG00631.140S ribosomal protein S8
SGD closest match:S000000168RPS8A40S ribosomal protein S8-A
CGD closest match:CAL0000186765RPS8A40S ribosomal protein S8

Protein alignments

%idAln lengthE-value
MIA_02517_185.22%2033e-125MIA_02517_1
A0A1E3PMJ1_9ASCO73.89%2037e-10740S ribosomal protein S8 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_69796 PE=3 SV=1
A0A167EHQ7_9ASCO74.50%2004e-10640S ribosomal protein S8 OS=Sugiyamaella lignohabitans GN=RPS8B PE=3 SV=1
A0A1E4TA51_9ASCO72.41%2039e-10640S ribosomal protein S8 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_125729 PE=3 SV=1
RS8A_YEAST70.50%2002e-10340S ribosomal protein S8-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS8A PE=1 SV=1
UniRef50_P0CX3970.50%2004e-10040S ribosomal protein S8-A n=299 Tax=Eukaryota TaxID=2759 RepID=RS8A_YEAST
A0A060TDD1_BLAAD69.61%2044e-10140S ribosomal protein S8 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D49940g PE=3 SV=1
A0A0F7RQD4_GEOCN71.78%2027e-10140S ribosomal protein S8 OS=Geotrichum candidum GN=BN980_GECA02s07281g PE=3 SV=1
Q59T44_CANAL69.42%2061e-9840S ribosomal protein S8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS8A PE=3 SV=1
Q6C0G4_YARLI69.00%2004e-9440S ribosomal protein S8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F24959g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9937
Predicted cleavage: 61

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF01201 (Ribosomal_S8e)
    1. PS01193 (RIBOSOMAL_S8E)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd11380 (Ribosomal_...)
  2. mobidb-lite (disord...)

Residue annotation

  1. 18S rRNA binding i...
  2. S11 protein interf...

Protein sequence

>MCA_01398_2
MSISRDSRHKRSHTGAKRSQYRKKRKFELGRQPSSTKIGAKRIHTVRVRGGNLKYRALRLEAGNFSWGSEGVTRKTRIIK
VAYHPSNNELVRTNTLTKASIVQIDATPFRQWYESHYAVPLGKKSNQAPTELAKPEGVSEAELAERQKTSSVESALETQF
GAGRIYAAISSRPGQSGRADGYILEGEELAFYLKKIVNKK

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome