Protein
MCA_01356_1
Length
475 amino acids
Gene name: MED4
Description: Mediator of RNA polymerase II transcription subunit 4
Browser: contigA:4232337-4233765+
RNA-seq: read pairs 1920, FPKM 49.8, percentile rank 65.3% (100% = highest expression)
Protein function
Annotation: | MED4 | Mediator of RNA polymerase II transcription subunit 4 | |
---|---|---|---|
EGGNOG: | 0PMRG | MED4 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity) |
SGD closest match: | S000005700 | MED4 | Mediator of RNA polymerase II transcription subunit 4 |
CGD closest match: | CAL0000181311 | MED4 | Mediator of RNA polymerase II transcription subunit 4 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_00969_1 | 44.98% | 438 | 4e-88 | MIA_00969_1 |
A0A0J9XDA6_GEOCN | 45.04% | 131 | 3e-23 | Similar to Saccharomyces cerevisiae YOR174W MED4 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA10s01836g PE=4 SV=1 |
UniRef50_A0A0J9XDA6 | 45.04% | 131 | 7e-20 | Similar to Saccharomyces cerevisiae YOR174W MED4 Subunit of the RNA polymerase II mediator complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XDA6_GEOCN |
A0A167C9B6_9ASCO | 67.31% | 52 | 2e-14 | Med4p OS=Sugiyamaella lignohabitans GN=MED4 PE=4 SV=1 |
A0A060T1U3_BLAAD | 46.05% | 76 | 5e-14 | ARAD1C23672p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C23672g PE=4 SV=1 |
A0A1E3PFC3_9ASCO | 47.73% | 88 | 7e-14 | Uncharacterized protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_5457 PE=4 SV=1 |
MED4_YEAST | 44.26% | 61 | 3e-08 | Mediator of RNA polymerase II transcription subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED4 PE=1 SV=1 |
MED4_YARLI | 33.33% | 87 | 3e-07 | Mediator of RNA polymerase II transcription subunit 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MED4 PE=3 SV=1 |
MED4_CANAL | 39.71% | 68 | 4e-06 | Mediator of RNA polymerase II transcription subunit 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED4 PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1161
Predicted cleavage: 69
Protein family membership
- Mediator complex, subunit Med4 (IPR019258)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_01356_1 MAYQFKSQLIPQPYSRVTTPAPSSQPFTPPPVQSFSNNPSTPSNARLKYLNANPNNMNRTLPGDSFYLNSNPNSFVNLKG AKSNDPISQNNNNNSNNNINNGNGTLSSSNYILPTDYQKPQVTHWLDVFETSLAQLVESISKFRPDMSKAEALVEAELEL ARAITQLTEDQKQARKIYQLRQVSKNLDEELNTLLITLADCRRTLRALPKPDEKFLKSLPDGVLDYTRELIQLHEQRSDS KDLFELVTEGINSGKTSETLQQQIQHGTQSNSLGGTNEDTINNINSDNKINKDGNLAKSVTLQEAIRRRRSSLAFSGKSL PDKPKVSANELLNYARKITKFTSAPLGYSPESRDNPAFNFPWPSEDELRRGVLALAATVGTIETNQGKASSSNDALADEK KPLEEGKEPTQQEDEKKTEDKQSNDNNNNNVMLGGGDNDSRMMDYRNDVIKPQPAAKIDLDLFDPDDDDDKDMEM
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex