Protein

MCA_01328_1

Length
220 amino acids

Gene name: URA5

Description: Orotate phosphoribosyltransferase

Browser: contigA:4163048-4163711+

RNA-seq: read pairs 2950, FPKM 164.9, percentile rank 85.9% (100% = highest expression)

Protein function

Annotation:URA5Orotate phosphoribosyltransferase
KEGG:K00762pyrE orotate phosphoribosyltransferase [EC:2.4.2.10]
EGGNOG:0QECUURA5orotate phosphoribosyltransferase
SGD closest match:S000004574URA5Orotate phosphoribosyltransferase 1
CGD closest match:CAL0000176894URA5Orotate phosphoribosyltransferase

Protein alignments

%idAln lengthE-value
MIA_04687_187.16%2181e-114MIA_04687_1
A0A1E3PPI4_9ASCO66.05%2153e-89Orotate phosphoribosyl transferase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46185 PE=3 SV=1
A0A060T1M2_BLAAD65.74%2161e-85ARAD1C25806p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25806g PE=3 SV=1
A0A0J9XCR5_GEOCN62.61%2307e-84Similar to Saccharomyces cerevisiae YML106W URA5 Major orotate phosphoribosyltransferase (OPRTase) isozyme that catalyzes the fifth enzymatic step in de novo biosynthesis of pyrimidines OS=Geotrichum candidum GN=BN980_GECA09s03420g PE=3 SV=1
PYRE_YARLI64.93%2115e-82Orotate phosphoribosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=URA5 PE=3 SV=1
UniRef50_P4192364.93%2111e-78Orotate phosphoribosyltransferase n=1032 Tax=root TaxID=1 RepID=PYRE_YARLI
A0A1D8PS11_CANAL64.02%2145e-82Orotate phosphoribosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URA5 PE=3 SV=1
PYRE_YEAST62.73%2203e-77Orotate phosphoribosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA5 PE=1 SV=2
A0A167CDF5_9ASCO57.53%2199e-76Orotate phosphoribosyltransferase URA5 OS=Sugiyamaella lignohabitans GN=URA5 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0550

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 220

Detailed signature matches

  1. Family IPR023031
    Orotate phosphoribosyltransferase
    1. MF_01208 (PyrE)
  2. Domain IPR029057
    Phosphoribosyltransferase-like
    1. SSF53271 (PRTase-like)
  3. Domain IPR000836
    Phosphoribosyltransferase domain
    1. cd06223 (PRTases_typeI)
    2. PF00156 (Pribosyltran)
  4. Domain IPR004467
    Orotate phosphoribosyl transferase domain
    1. TIGR00336
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.50...

Residue annotation

  1. active site cd06223

Protein sequence

>MCA_01328_1
MSVDHQAIFIDAALSSSALKFGQFTLKSGRVSPYFFNLGLFNTGLNLSSLATAYASTIIESGIKFDVLFGPAYKGIPLAA
LTAAKLAEIDPENWGHVEYAFNRKEKKDHGEGGNIVGAPLEGKKVFIIDDVMTAGTAINESFTILKENKAIVVGVIIALD
RQERTVDSEKSAVQVVSAKYGIPVLSITNLDKIIDYLGDRLTAEELQKINEYKATYAPKP

GO term prediction

Biological Process

GO:0006221 pyrimidine nucleotide biosynthetic process
GO:0009116 nucleoside metabolic process

Molecular Function

GO:0004588 orotate phosphoribosyltransferase activity

Cellular Component

None predicted.