Protein
MCA_01325_2
Length
161 amino acids
Gene name: COX4
Description: Cytochrome c oxidase subunit 4, mitochondrial
Browser: contigA:4158455-4158941-
RNA-seq: read pairs 66550, FPKM 5075.9, percentile rank 99.6% (100% = highest expression)
Protein function
Annotation: | COX4 | Cytochrome c oxidase subunit 4, mitochondrial | |
---|---|---|---|
KEGG: | K02265 | COX5B | cytochrome c oxidase subunit 5b |
EGGNOG: | 0PR50 | COX4 | cytochrome c oxidase polypeptide iv |
SGD closest match: | S000003155 | COX4 | Cytochrome c oxidase subunit 4, mitochondrial |
CGD closest match: | CAL0000200309 | COX4 | Cytochrome c oxidase subunit IV |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XBB9_GEOCN | 82.39% | 142 | 7e-74 | Similar to Saccharomyces cerevisiae YGL187C COX4 Subunit IV of cytochrome c oxidase, the terminal member of the mitochondrial inner membrane electron transport chain OS=Geotrichum candidum GN=BN980_GECA08s04146g PE=4 SV=1 |
MIA_04684_1 | 81.12% | 143 | 2e-70 | MIA_04684_1 |
COX4_YEAST | 61.97% | 142 | 7e-53 | Cytochrome c oxidase subunit 4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX4 PE=1 SV=1 |
UniRef50_P04037 | 61.97% | 142 | 2e-49 | Cytochrome c oxidase subunit 4, mitochondrial n=81 Tax=Dikarya TaxID=451864 RepID=COX4_YEAST |
A0A060T826_BLAAD | 58.94% | 151 | 3e-50 | ARAD1D00418p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D00418g PE=4 SV=1 |
A0A1E3PTA1_9ASCO | 64.12% | 131 | 2e-49 | COX5B-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_19464 PE=4 SV=1 |
A0A167FBI1_9ASCO | 54.23% | 142 | 3e-42 | Cytochrome c oxidase subunit IV OS=Sugiyamaella lignohabitans GN=COX4 PE=4 SV=1 |
A0A1E4TB49_9ASCO | 55.86% | 145 | 4e-41 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32380 PE=4 SV=1 |
Q6C5A3_YARLI | 53.10% | 145 | 9e-31 | YALI0E19723p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E19723g PE=4 SV=1 |
Q5ALV5_CANAL | 51.54% | 130 | 9e-28 | Cytochrome c oxidase subunit IV OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX4 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9956
Predicted cleavage: 29
Protein family membership
- Cytochrome c oxidase, subunit Vb (IPR002124)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
SSF57802 (Rubredoxi...)
Protein sequence
>MCA_01325_2 MIVPVARIAVRAARPMAARSFSVAAFLRNKEVETKTATTLAEVRGPETLIGTPAPEGTIPTDLQQATGLERLELLGLREG IDIFDRRPLDASRKGTMADPIVVDSYEDYRYVGCTGFPAGSHEVQWLKPTTEKKARCWECGNVYTINNLSVPVEGGDEHH H
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004129 cytochrome-c oxidase activity
Cellular Component
GO:0005740 mitochondrial envelope